KEGG   Bacillus velezensis NAU-B3: BAPNAU_2665
Entry
BAPNAU_2665       CDS       T02859                                 
Symbol
med
Name
(GenBank) Transcriptional activator protein med
  KO
K05519  transcriptional activator of comK gene
Organism
bamb  Bacillus velezensis NAU-B3
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bamb03000]
    BAPNAU_2665 (med)
Transcription factors [BR:bamb03000]
 Prokaryotic type
  Other transcription factors
   Others
    BAPNAU_2665 (med)
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: CDH96445
LinkDB
Position
complement(2840603..2841556)
AA seq 317 aa
MITRLVMTFSVLLLLSGCAQTPFKGKIEKVGMLFPDTISDLVWGTKGYKGLLAIQSEFNV
DVYYKENIRSDEDILKAIDDFHKKGVNLLYGHGNEYEEIFNMISKDYPDMEFVVANGTAK
SDNVTSVHLMGEAMGFFGGMTAAHMSKNNEVGVIASFLWQPEVDGFIKGAKYEKPDITVN
TEFTDHWDNGNEALHLYEKLKAEGTDVVYPAGDGYNVPVIQQIKKDGLYAIGYVAEQSNL
GKNTVLTSTVQNVDKAYTLIAEQYNKGTLKSGDHNFDFREGVVEMGTFSPLVDKAFQDKI
SDLVKTYNRTNELPSNE
NT seq 954 nt   +upstreamnt  +downstreamnt
ttgatcaccaggcttgtcatgaccttttctgtcctccttttattgagcggatgcgcacaa
actccgtttaaaggaaaaattgagaaggtcggaatgctttttcccgataccatcagtgac
ttggtatgggggacaaaaggttacaaaggtttattagcgatacaatctgaatttaacgtt
gacgtttattataaagaaaatatcagatccgatgaagatattttaaaagcgatagatgat
tttcataaaaaaggagtcaatcttttatacgggcacggaaatgaatacgaggaaattttc
aatatgatcagcaaggattatcccgacatggaattcgtcgtcgcaaacggaacggcgaaa
agcgataatgtcacaagcgttcatcttatgggagaagcaatgggctttttcgggggaatg
acggccgcccatatgtcaaaaaacaatgaggtcggcgtcatcgcctcttttttgtggcag
cctgaagtagacggctttatcaaaggagcgaaatatgaaaagcctgatatcaccgtcaat
actgaatttacggaccactgggataacggcaatgaagcgctgcatctttacgagaagtta
aaagcggaaggcacggatgttgtatatccggccggagacgggtataatgttcctgtcatt
cagcaaatcaaaaaagacgggctttacgccatcggctatgtcgccgagcaatcgaatctc
ggcaaaaacacggtgctgacaagcacggtgcaaaacgtagataaagcctatacattaatt
gccgagcaatataataaaggtacgctcaagagcggagatcacaacttcgatttcagggaa
ggagtcgttgaaatggggacgttcagccctctggtggacaaagcatttcaagacaaaatc
tcagaccttgtcaaaacgtataacagaacaaatgaactgccgtcaaatgaatag

DBGET integrated database retrieval system