KEGG   Bacillus amyloliquefaciens CC178: U471_18990
Entry
U471_18990        CDS       T02893                                 
Name
(GenBank) fenC
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
bamc01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bamc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    U471_18990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bamc01008]
    U471_18990
Polyketide biosynthesis proteins [BR:bamc01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    U471_18990
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: AGZ56601
LinkDB
Position
complement(1941312..1948961)
AA seq 2549 aa
MGQQPEIQDIYPLSFMQEGMLFHSLLDHDSRAYFEQAVFTISGQLDRERFQKSIDAVFER
YDIFRTTFIHKNVAKPRQVVLKNRPSRVQFHDISHLDEKAQDKYADRFRKEDKDKGFDLQ
SDPLMRVSILKKGPERYVCIWSHHHIVMDGWCFGIVMKEFLMIYQSLGDGWLPSLEPVQP
YGKYIKWLMKQDRKEAEIFWKTRLADLEQSASLPKKSAEPNGELEQAVFTISEEQTNELK
NIAARAGATLNTVFQALWGILLQRVSRCDDAVFGSVVSGRPSDLTGVEKMVGLFINTIPV
RVKSGSFSFLELVRHLQQETLQAEAYSYYPLYDIQAQSPLKQALFDHIIVFENVPAQREI
ENVSQAGSFDFAVEDFTMEEVTNYGCSIKVIPGNSLYIRLNFDTGIYDRIFMKNIETFLR
HMMNSVISDPEICASEIALLDACEARSMLDAFNRTETVEPPAPTLHGLFARRAALSPHRP
ALRFPGGMLTYAELDQYTDRLAVRLRQKGVRKESMVGVLAERSPEMVVSVLAVLKAGGAY
VPLDPEYPEDRLRYMLDDCGACLLLAQPGLSVSGFSGETLEVSLSALTSEAETGAVSEEA
DADSLAYIIYTSGSTGTPKGVAVEHRQAAAFLSGMQGQFPLTEEDIIVLKSSFSFDASIW
QLFWWTMSGASVYLLPAGWEKDPVRMIEAFASEKVTTAHFIPAMVNSFLDALETEPAETR
TRLGRTLTRVFAGGEALSPLTAARFADLLPETVLIHGYGPTEATVDAAFYVCDRKRDSGR
TRLPIGKPVPGARLYVLDSGGTIQPAGVAGELYIAGTGVARGYLNRPELTEERFLDDPFY
PGERMYQTGDIARWTEDGLVEWLGRSDGQVKVRGYRIEPGEIEAAIRRIDGIREAAVTAR
NEHGETALYAYIEGRESDDVRAELATRLPAYMMPAQFIKMTEWPVTPSGKLDRRALPAPG
GAADRQAYTAPRNVTEMKLCALWEEVLKNGPVGIRDHFFERGGHSLKATALVSRIAKEFG
VQVPLQDIFARPTVEELASVIQDLEESPYEAIQPAQKQDTYPVSSAQKRMYVLQQLEDGG
VGYNMPAVLELTGPLDRGRLEETFRQLVERHESLRTSFETGPDGEPVQRIHDSVPFQLDE
AGSADAFVRPFCLEEAPLFRAALVKESDERHLLLTDMHHIISDGVSVNTLIKEFGELYAG
RSLAPMRLQYKDYAVWQRSFQEKEGYQKQEAYWLKRLEGELPVLELPADKPRPAVRSFAG
GSVSCTLDAETASGLHRIARDHGSTLYMVLLAAYNTLLARLSGQEDIIVGSPIAGRPHKD
LEPILGMFVNTLAIRTEPKGDKRFTDYLAEVRQAALEAYEHQDYPFEELVERLGVQRDMS
RNPLFDVMFVLQNMERESLVLNKLHLAQAADTSHKTAKFDATLYASEGSDGSISFDFEFN
TDVYQKQTIEKWLSYFTRILTKVIENQAIPLGDIHVLDDAETNRVIYQFNQTKSDYPRHE
TISRLFERQAKETPDARAVVYDGQILTYRELNERANRIAAALRSNSVGPESVVALLTGRT
TELASGILGILKAGGAYLPIGDDVPRERAEWMLKDCKADILLQSDKLDGLPLSGKRLFIE
DIQTKAGLSSENPEPLGGPESLAYMIYTSGSTGAPKGVMIEQRSVIRLVKNSNYIDFTPE
DRLLFTSSLGFDVTTFEIFGPLLNGASLYVSDQETYLDSDVLETFIQQNGITTLWLTSSL
FNHLSEQNEHVFSGLSRLIIGGEALSPSHVNRVRNALPHLSVWNGYGPTENTTFSTYFLI
EQSYDHSIPIGRPVGNSTAYIINSRGTPQPIGVIGELCTGGDGVARGYFGRPELTEEKFV
PNPFVPGERMYRTGDLARWLPDGTIEYAGRMDDQVKIRGYRVELGEIEAALRSLDGVKEA
AVSVRTGQSGNKELIAYMSLQADMDTEKVRSLLSKQLPNYMVPAYMMELEKLPLTPNGKL
DRKNLPEPELALQTAYTAPRNELEEQLSVIWQEVLGTKQVGIEDSFFELGGDSIKALQVS
ARLGRYGWKMTASDLFRHPSIKELAPLIRKAERVIDQRPVEGDIPWTPVQHWFLSQRMEN
RNHFNQSVMMFSSDALHKQPLKEVLEHLVIHHDALRITVSAENESFRQINHGIQKDELYS
LDIWDLSETDTWEKEIESEVAALQQRMDIEKGPLLKAGWFKTRSGDYLFITVHHLAVDGV
SWRILLEDLSAAYTQAVKGQPVQLPPKTDSFKQYAERLSEYAKSSKLMREEEYWRFIEEE
TAAELPYEKPQHQTGADSIRQTVSFTLTEEETSVLLQQVNRAYHTDTQDILLTAAALALR
DWTGGGRLRIAMEGHGREHIMPELDISRTVGWFTSMYPVLIDLNTAGAELGTAVKTVKDT
LGRIPDKGIGYGILKYMTPPEQKTIRFRQAPEISFNYLGQFNDTEDQHTFSLSGLASGHD
ITPTWQREQAVEMSAMAAQNKLHFSLSYPPSRFRKETMEQLLQTLQQYLRDIMAHCTGKE
EAEKTVSDFSSKTLTSDDLDSIASFVEEL
NT seq 7650 nt   +upstreamnt  +downstreamnt
atggggcagcaaccggaaatacaagatatatatcctttatcttttatgcaggagggcatg
ctttttcattctctgttggatcatgactcaagagcctacttcgaacaagcggtgtttacg
atcagcggacagcttgaccgggaacgattccaaaaaagtatagatgctgtttttgaacga
tacgatattttccgtacgacatttattcataagaatgtggcgaagccccgccaagtcgtg
ttgaaaaacaggccgagccgcgttcagtttcatgatatttctcatttggacgagaaggca
caagataaatatgccgaccgattcagaaaggaagataaagataaaggctttgatttgcaa
tcagaccctctcatgagagtctccattttgaaaaaagggcctgaacgctatgtttgtata
tggagccatcatcatatcgtcatggacggctggtgcttcgggattgtcatgaaggaattt
ctgatgatctatcaatctctcggagacgggtggctcccgtctctcgagcctgttcagcca
tatggtaagtatattaaatggctcatgaagcaggatcgtaaagaagccgagattttttgg
aaaacgagacttgccgatcttgagcaatcggcgtctcttccgaaaaaatccgcggaacca
aatggcgaacttgagcaggcggttttcaccatttctgaagagcagacaaatgagctgaag
aacattgcggcaagggcgggagcaacgctgaatacagtgttccaggcactgtggggcatt
ttgctccagcgtgtcagccgctgtgatgacgccgttttcggttctgtcgtttccggccgg
ccgtcggatctcacaggcgtggaaaaaatggtggggctgtttattaatacgattcccgtg
cgggtgaaaagcggttcattttcttttctggagctcgtcaggcatttgcagcaggagacg
ctgcaagcagaagcgtacagctattatccgctgtatgacattcaggcgcaaagccctttg
aagcaagcgctgtttgaccacattatcgtgtttgaaaatgtgccggcccagcgtgaaatt
gaaaatgtgagtcaggccggttcatttgattttgcggtagaagatttcacgatggaggaa
gtcacaaactacggatgcagcataaaggtgattccgggaaattctctttatatccgctta
aactttgataccggtatatacgatcgtatttttatgaagaatattgaaacatttttacgg
catatgatgaattcagtcatctccgatcctgaaatttgcgcctccgagatcgcattgctt
gatgcgtgtgaagccagaagtatgcttgatgcgtttaaccgtacagaaacggttgaaccg
ccggctccgacgcttcacgggctgtttgcccgccgtgccgcgctttcgccgcatcgtccg
gcgctccgttttccgggcggcatgctgacgtacgccgagcttgaccagtacacagacaga
ctcgctgttcggctccgccaaaaaggcgtccgcaaagaaagcatggtcggcgtactcgct
gaacgctcgccggagatggtggtttctgtgcttgccgtgttaaaagcgggcggcgcctac
gtgccgcttgacccggagtatcctgaggacaggctgcgctatatgctcgacgactgcggc
gcttgtcttctgctcgcacagccggggttatccgtttccggtttttccggagaaacgcta
gaagtgtctctttctgctctgacaagtgaggcggagacaggggctgtctctgaagaagcg
gatgctgattcgctcgcttatatcatttatacgtccggttcgacgggaacaccgaaggga
gtagctgttgaacaccgtcaggccgccgcctttttatcagggatgcaagggcagttcccg
ttgacagaagaggatattatcgtgctgaaatcatccttttctttcgacgcctccatctgg
caattgttttggtggacgatgtccggcgcctccgtgtatctgcttccggccggctgggag
aaagatcctgtgcggatgattgaagcgtttgcctcagaaaaggtgacgaccgcgcatttt
attccggcgatggtcaacagctttttagacgcgctggaaacagagcctgcggaaacaaga
acacgcctcggcagaaccttgacacgcgtgtttgccggaggggaagctctttcaccgctt
acggctgcccggtttgccgatcttctgccggagaccgtgcttattcacggctacgggccg
acggaagcgacggttgatgcggcgttttacgtctgtgaccgaaaacgggacagcggacgg
acgcggcttccgatcggaaaacccgttccgggtgcccgtctgtatgtattagatagcgga
ggaaccatccagcctgcgggcgtggcaggagagctgtacatcgcggggacaggggtggcc
cggggctatctgaaccggcctgagctgacggaggagcgttttctcgatgatccgttttat
ccgggagagcgcatgtatcagacgggcgatatcgcacgctggacagaagacggccttgtc
gaatggctaggacgttcagacggacaggtgaaagtccgcggctaccggattgaaccggga
gagatcgaagcggcgatccggcgcatcgacggcattcgtgaggcggcggtcaccgcccgg
aacgaacacggcgaaaccgcgctttacgcctatattgaaggacgggaaagcgatgacgtg
cgggcggagcttgcgacacgccttccggcttacatgatgccagctcagttcataaagatg
accgaatggccggtcacaccgagcggaaagcttgaccgccgcgcgctgccggctcccggc
ggagcggcagacagacaggcgtacaccgccccgcggaacgtcacggaaatgaagctttgc
gccctttgggaagaggtgctgaaaaacggccccgtcggcatccgggatcacttttttgag
cggggcggccattcgttaaaagcgacggctctcgtctcccgcatcgccaaagagttcggt
gttcaggtgccgttacaagacatcttcgcccggccgacggtggaagagctcgcttcggtc
attcaggacttggaagagagcccgtatgaagcgattcagcctgcgcaaaaacaggacacc
tacccggtgtcttcggcgcagaaacggatgtatgtgctccagcagcttgaagacggcggt
gtcggctacaatatgccggctgtgctggaactgacgggcccgcttgaccgcggccggctg
gaggagacgttccggcagcttgttgagcggcatgagtcgctcagaacgtcctttgaaacg
gggcctgacggcgaaccggtgcagcgcatccatgacagcgtaccgtttcagctggatgag
gccgggtcagctgacgcattcgtccggccgttttgtctggaggaagcgccgctcttccgt
gcggccctcgtgaaagaatcggacgaacgtcatcttttattaacggatatgcatcatatt
atttctgacggtgtgtccgtcaacaccttgattaaagaattcggcgagctgtacgcaggc
cgttcgcttgcgccaatgcgccttcaatataaagactatgccgtctggcagcggtcgttt
caggagaaagaagggtaccagaagcaggaagcctactggctgaagcggctagaaggagag
cttccggtgcttgaacttccggctgacaagccccgtccggctgtcagaagctttgcgggc
ggcagcgtatcgtgcacgcttgacgctgaaacggcatccggccttcaccgcattgcccgg
gatcacggctccactttgtatatggtgcttctcgccgcgtacaatacgttactcgcgcgc
ctgagcgggcaggaagacatcatcgtcggctcgccgattgccgggcgtccgcacaaagac
cttgaaccgattctcggcatgttcgtcaacacgctcgccatcagaacggagccgaaagga
gacaaacggtttaccgattacttggcggaagtccgccaggccgcgcttgaggcgtatgag
catcaggactatccgtttgaagagctagtggaacggctcggtgtgcagcgggacatgagc
cgaaatccgctgtttgatgtgatgtttgtgctccaaaatatggagcgtgaatccctggtg
ttaaataagctgcatttggctcaagctgcggatacaagtcataaaaccgcaaagtttgat
gccacgctttacgcgtcagaagggtctgacggttccatcagctttgattttgaattcaat
acagatgtctatcaaaaacagacaattgaaaaatggctttcttattttacccgtattctt
acaaaagtaattgaaaaccaagcgataccgcttggtgacattcacgtactggatgatgct
gaaacaaatcgcgtcatttatcagtttaatcagacgaaaagcgattacccaagacacgaa
accatcagccgtttatttgagcggcaggcaaaagaaacccccgatgcccgggcagttgta
tatgatggacaaatcttgacataccgtgagctgaacgaacgggctaacagaatagcggcg
gctctccgatcaaatagcgtcggtccggaaagcgttgtcgcattattaaccggccgcaca
acagagcttgcttccggaatcctcggaatattaaaagcgggaggcgcctacttgcctatc
ggtgacgatgtgccgcgggaacgggctgaatggatgcttaaagactgtaaagctgatatt
cttctccaatctgataaacttgacggtctgccgctttcaggaaaacgtttattcatagag
gatattcaaacaaaggccggattgagttcggaaaatcccgaaccgctcggcggacctgaa
tcattggcctacatgatttatacgtccggatcaacaggtgcgccaaaaggcgtcatgatt
gaacagcgaagcgtgatccgccttgtgaaaaacagcaattatattgattttacgccggaa
gatagactgttatttacttcatcattaggatttgacgttacaacatttgaaatattcggt
ccgcttttaaacggcgcttctttatatgtaagtgaccaggaaacctatctcgactctgat
gttttggaaacatttatacagcaaaacggcattacgacactgtggctgacatcgtctctg
ttcaaccatttatcagaacaaaatgaacacgtgttttccggattatcccgattgattatc
ggcggggaagcactgtccccaagccatgtaaaccgggttcggaatgcgctgccgcatctc
tcagtatggaatggatacggaccgactgaaaacacgacgttctcgacttactttttgatt
gaacaatcatacgatcattcaatcccgatcggccgccctgtcggaaattcaaccgcatat
atcataaacagcaggggaacaccgcagccgatcggagtcatcggcgaattatgcacaggc
ggagacggtgtggcaagaggatatttcggccgccctgagctgacggaagaaaaatttgtc
cctaatccttttgttcccggagaacggatgtaccgcaccggagatttagcccgctggctg
ccggacggaacgatcgaatatgccgggcggatggatgatcaagtgaaaatccgcggttat
cgggtcgagctgggagagattgaagccgcactgaggagcctggacggcgtgaaagaagct
gccgtgtcagtcagaaccgggcagtccggcaataaagaactgatcgcatatatgagtctg
caggcggacatggatacagaaaaagtgcgttctttactgtctaagcaactgccgaattac
atggttccggcctatatgatggaacttgagaagctgccgcttacgccgaacggtaaattg
gatcggaaaaatctgcccgaaccggagctcgcgcttcaaaccgcgtacacagctccccgc
aatgagcttgaagaacagctttccgtgatctggcaggaagtgctcggcacaaaacaagtc
gggattgaggactcattttttgagttgggcggcgattcaatcaaagcgctgcaagtttcc
gcacggctcggacgctatgggtggaaaatgacggcaagcgacttattccggcatccgtcc
attaaggagctcgcgccacttatccggaaagcggaaagagtcatcgatcagcggccggtg
gaaggagacataccttggacacccgttcagcactggtttttatcacagcggatggaaaac
agaaatcatttcaatcagtccgtcatgatgttcagctctgacgcattgcataaacagccg
ctcaaagaagtcttagagcatcttgtcattcatcatgatgcactccggataaccgtcagt
gcagaaaacgaaagtttcagacaaatcaatcacggtattcaaaaagatgaactgtacagc
ttggacatttgggatctgtctgagacagatacttgggaaaaagaaatagaaagtgaagtc
gctgcgctccaacagcggatggatattgaaaaaggcccgttattaaaagccggctggttc
aaaacccggtccggagattatttattcatcaccgtacatcacctggcggttgacggagtg
tcatggcgtattttgctggaggatttatctgccgcttacactcaagccgtaaaaggtcag
ccggtccagcttccgccaaagaccgattcgtttaagcaatacgctgaaaggctttcagaa
tacgcaaaaagcagcaagctgatgcgtgaagaagaatattggcgttttattgaagaagaa
acagccgccgaacttccttatgaaaaaccgcagcatcagacgggagccgacagcattcgg
caaacggtaagctttacgcttacagaagaagaaacgtccgttttgcttcagcaggtcaac
cgggcctaccataccgatacgcaagatattcttctgactgccgcagctttggctttacgg
gactggacagggggcggcagactgcgcatcgcgatggaagggcacgggagagagcacatc
atgccggagctcgacatcagccgcaccgtaggctggtttacctccatgtatccggtgctc
attgacttgaacacagcaggcgctgagcttggaacggcggtaaaaacggtcaaagacaca
ctcggaagaataccggataaaggaataggctacggcattttaaaatacatgacaccgcct
gaacaaaaaacaatccgcttcagacaagcgcctgaaatcagctttaactatttagggcaa
ttcaatgatacagaagatcagcacacgttcagtctgtccggtcttgcaagcgggcacgac
atcacgccgacatggcagcgggaacaagcggtggaaatgagcgcgatggccgcacaaaac
aaacttcacttcagtttgagctatccgccgagccgcttccgcaaagaaacaatggaacag
ctgctgcaaactttacagcaatatttgcgtgatattatggcgcactgcacaggcaaagag
gaagcagaaaaaaccgttagtgattttagcagcaaaacgttaacatctgatgatttggac
agcatagcgagttttgtcgaggaactgtag

DBGET integrated database retrieval system