KEGG   Bacillus amyloliquefaciens LFB112: U722_09650
Entry
U722_09650        CDS       T02965                                 
Name
(GenBank) cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
bamf00780  Biotin metabolism
bamf01100  Metabolic pathways
bamf01240  Biosynthesis of cofactors
Module
bamf_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    U722_09650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bamf00199]
    U722_09650
Enzymes [BR:bamf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     U722_09650
Cytochrome P450 [BR:bamf00199]
 Cytochrome P450, bacteria type
  CYP107 family
   U722_09650
SSDB
Motif
Pfam: p450 HU-CCDC81_euk_2
Other DBs
NCBI-ProteinID: AHC42362
LinkDB
Position
complement(1954117..1955313)
AA seq 398 aa
MTAGLSTAHPSLHADSDFWNDPYPFYEKLRAIDPVYKGTVLKHPGWYVTGYKEAAAILKD
TRFKNRVPFPEASTKYQNLSHIQHDMLLFKNQSDHKRMRMLIGKEFTAKTAESLRPCIKE
TVHDLLDQIQNKKNADLVSEFAFPLASLIIAEILGVPKEERYQFRQWTADVIQAIDLTRS
RKMLVRASDTAGRLTAYFRDLIHERKAHPQEDLISRFIMGEQLSKDEVLATCILLVIAGH
ETTVNLMSNGVFTLLKHPEQLSALRENPSLIETAVEECLRYDSPAQLTARTASEDCEING
KTIKKGEQVYILLGAANRDPSIFDQPHKMDIQRKPNPHLAFGKNAHFCIGSSLARIEAQI
AILTLFERMPKLRLAAHRLEYRKLIGFRSLKELPVVLG
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgacggcgggcctatcgactgcacatccgtccctccatgcggattcggatttttggaat
gacccttacccgttttatgaaaaactgcgtgccattgatcctgtttataaaggaaccgta
ttaaaacatccgggctggtatgtcaccgggtataaagaagcggcagcgattttgaaagac
acccggtttaaaaaccgcgtcccttttccggaagcttcaacgaaatatcaaaatctatct
catatccagcacgatatgctgttatttaaaaatcaatcagaccataagcggatgcggatg
cttataggtaaagaatttaccgcaaagacggcggaatcacttcgcccctgtataaaagaa
acggttcatgacttgttggatcaaatccaaaacaaaaaaaacgcagaccttgtttcagag
tttgcctttccattggcaagcctcatcattgcggagatactcggagtgccgaaagaggag
agatatcaattcagacaatggacggcagacgtcattcaggccattgatcttacccggtca
agaaagatgttagtcagagcaagcgacaccgcaggcaggctgactgcatatttcagagat
ttgattcacgagcggaaagcacatcctcaggaagacttaatcagcaggtttattatgggg
gaacagctttcaaaagacgaagtgctcgcgacatgtatcttacttgtcatagccggacac
gagacgacggtaaacctcatgagcaacggtgtgtttactttattgaaacaccctgaacag
cttagcgcactgagagaaaacccctcgcttattgaaactgctgtcgaggaatgtctgcgc
tacgacagccccgcgcagctgacggcacgcaccgcttcagaagactgtgaaataaatggg
aagaccataaaaaaaggagagcaggtatatatccttttaggggcagccaatcgcgatcca
agcatattcgatcagcctcataaaatggacatccaaagaaaaccgaatccgcatcttgca
ttcggaaagaacgcccatttttgcataggctcctcattagcgcgcatcgaagcacaaatt
gcaattctcacactgtttgagcggatgcctaagcttcggctggccgcacaccgccttgaa
taccgcaagctcattggttttaggtcgctcaaagagcttccggttgtccttggctga

DBGET integrated database retrieval system