KEGG   Bacillus amyloliquefaciens IT-45: KSO_010145
Entry
KSO_010145        CDS       T02462                                 
Name
(GenBank) Fengycin non-ribosomal peptide synthetase FenC
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
bami01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bami00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    KSO_010145
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bami01008]
    KSO_010145
Polyketide biosynthesis proteins [BR:bami01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    KSO_010145
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: AGF27524
LinkDB
Position
1949376..1957025
AA seq 2549 aa
MGQQPEIQDIYPLSFMQEGMLFHSLLDHDSRAYFEQAVFTISGKLDRERFQKSIDTVFER
YDIFRTTFIHKNVAKPRQVVLKNRPSRVQFHDISHLDEKAQDKYADRFRKEDKDKGFDLQ
SDPLMRVSILKKAPERYVCIWSHHHIVMDGWCFGIVMKEFLVIYQSLGDGRLPSLEPVQP
YGKYIKWLMKQDRKEAEIFWKTRLADLEQTASLPKKSAEPNGELEQAVFTISEEQTNELK
NIAARAGATLNTVFQALWGILLQRVSRCDDAVFGSVVSGRPSDLAGVEKMVGLFINTIPV
RVKSGSFSFLELVRHLQQETLQAEAYSYYPLYDIQAQSPLKQALFDHIIVFENVPAQREI
ENVSQAGSFDFAVEDFTMEEVTNYGCSIKVIPGNSLYIRLKFDTGIYDDVFMKNIETFLR
HMVNSVISDPEIGASEIALLDACEARSMMDAFNHTEAVEPPAPTLHGLFARRAALSPHRP
ALRFPGGMLTYAELDQYTDRLAVRLRQKGVRKESMVGVLAERSPEMVVSVLAVLKAGGAY
VPLDPDYPEDRLRYMLEDSGACLLLAQPGLSVPGFSGETLEVSLSALTGETETGAVSDEA
DADSLAYIIYTSGSTGTPKGVAVEHRQAAAFLSGMQGQFPLTEEDVIVLKSSFSFDASIW
QLFWWTMSGASVYLLPAGWEKDPVRMIEAFASEKVTTAHFIPAMVNSFLDALETVPAETR
ARLGRTLTRVFAGGEALSPLTAARFADLLPETMLIHGYGPTEATVDAAFYVCDRKRDSGR
TRLPIGKPVPGARLYVLDSGGTIQPAGVAGELYIAGTGVARGYLNRPELTEERFVDDPFY
PGERMYQTGDIARWTEDGLVEWLGRSDGQVKVRGYRIEPGEIEAAIRRIDGIREAAVTAR
TEHGETALYAYIEGRKSDDVRAELAARLPAYMMPAQFIKMTEWPVTPSGKLDRRALPAPG
GSADRQTYTAPRNVTEMKLCALWEEVLKNGPVGIRDHFFERGGHSLKATALVSRIAKEFG
VQVPLQDIFARPTVEELASVIQDLEESPYEAIQPAKKQDTYPVSSAQKRMYVLQQLEDGG
VGYNMPAVLELTGPLDRSRLEETFRQLVERHESLRTSFETGPDGEPVQRIHDSVPFQLDE
AESADAFVRPFCLEEAPLFRAALVKESDERHLLLTDMHHIISDGVSVNTLIKEFGELYAG
RSLAPMRLQYKDYAVWQRSFQEKEGYQKQEAYWLKRLEGELPVLELPADKPRPAVRSFAG
GSVSCTLDADTASGLHRIARDHGSTLYMVLLAAYNTLLARLSGQEDIIVGSPIAGRPHKD
LEPILGMFVNTLAIRTEPKGDKRFTDYLAEVRQAALEAYEHQDYPFEELVERLGVQRDMS
RNPLFDVMFVLQNMERESLNLNELHLTQAADTGHKTAKFDATLYAAEGSEGSISFDFEFN
TDIYQKQTIEKWLSYFTRILTKVIEDQTIPLGDIHVLDDAETNRVIYQFNQTKSDYPRHE
TISRLFERQAEETPDARAVVYDGQILTYRELNERANRIAAALRSNGVGPESVVALLTGRT
TELASGILGILKAGGAYLPIGDDVPRERAEWMLKDCKADILLQSDKLDGLPLSGKRLFIE
DIQTKAGLSSENPEPLGGPESLAYMIYTSGSTGAPKGVMIEQRSVIRLVKNSNYIDFTPK
DRLLFTSSLGFDVTTFEIFGPLLNGASLYVSDQETYLDSDILETFIQQNGITTLWLTSSL
FNHLSEQNEHVFSGLSRLIIGGEALSPSHVNRVRKTLPHLSIWNGYGPTENTTFSTCFLI
EQSYDHSIPIGRPVGNSTAYIINSRGTPQPIGVIGELCTGGDGVARGYFGRPELTEEKFV
PNPFVPGERMYRTGDLARWLPDGTIEYAGRMDDQVKIRGYRVELGEIEAALRSLDGVKEA
AVSVRTGQSGNKELIAYMSLQTDMDTEKVRSSLSKQLPNYMVPAYMMELEKLPLTPNGKL
DRKNLPEPVLVLQTAYTAPRNELEEQLSVIWQEVLGTKQVGIEDSFFELGGDSIKALQVA
ARLGRYGWKMTASDLFRHPSIKELAPLIRKAERVIDQRPVEGDIPWTPVQHWFLSQRMEN
RNHFNQSVMMFSSDALHKQPLKQALEHLVIHHDALRITVSSENESIRQINHGIQKDELYS
LDIWDLSETDTWEREIEDEVAALQQRMDIEKGPLLKAGWFKTRSGDYLFITVHHLAVDGV
SWRILLEDLSAAYTHAVKGQPVQLPPKTDSFKQYAVRLSEYAKSSKLMREEEYWRFIEEE
TAAGLPYEKPQHQTGADSIRQTVSFTLTEEETSVLLQQVNRAYHTDTQDILLTAAALALR
DWTGGGRLRIAMEGHGREHIMPELDISRTVGWFTSMYPVLIDLNTAGAELGTAVKTVKDT
LGRIPDKGIGYGILKYMTPPEQKTIRFRQAPEISFNYLGQFNDTEEQHTFSLSGLASGHD
ITPTWQREQAVEMSAMAAQHKLHFSLSYPPSRFRKETMEQLLQTLQQYLRDIMAHCTGKE
EAEKTVSDFSSKTLTSDDLDSIASFVEEL
NT seq 7650 nt   +upstreamnt  +downstreamnt
atggggcagcaaccggaaatacaagatatatatcctttgtcttttatgcaggagggcatg
ctttttcattctctgttggatcatgactcaagagcctacttcgaacaagcggtgtttacg
atcagcggaaagcttgaccgggaacggttccaaaaaagtatagacactgtttttgaacga
tacgatattttccgtacgacatttattcacaagaatgtggcaaagccccgacaagtcgtg
ttgaaaaacaggccgagccgcgttcagtttcatgatatttctcatttggacgagaaggcg
caagacaaatatgccgaccggttcagaaaagaagataaagataaaggctttgatttgcaa
tcagaccctctcatgagagtctccattttgaaaaaagcgcctgaacgctatgtttgtata
tggagccatcatcatattgtcatggacggctggtgcttcggaattgtcatgaaggaattt
ctggtgatctatcaatctctcggagacggacggcttccgtctctcgagcctgttcagcca
tatgggaagtatattaaatggctcatgaagcaggatcgtaaagaagccgagattttttgg
aaaacgagacttgccgatcttgagcaaacggcgtctcttccgaaaaaatccgcggaacca
aacggcgaacttgagcaggcggttttcaccatttctgaagagcagacaaatgagctgaag
aacattgcggcaagggcgggagcaacgctgaatacagtgttccaggcactgtggggcatt
ttgctgcagcgtgtcagccgctgtgatgatgccgttttcggttctgtcgtttccggccgg
ccgtcggatctcgcaggcgtggaaaaaatggtgggactgtttatcaatacgattcccgta
cgggtgaaaagcggttcattttcttttctggagcttgtcaggcatttgcagcaggagacg
ctgcaagcagaagcgtacagctattatccgctgtatgacattcaggcgcaaagccctctg
aagcaagcgctgtttgaccacattatcgtgtttgaaaatgtgccggcccagcgtgaaatt
gaaaatgtgagtcaggccggttcatttgattttgcggtagaggattttacgatggaagaa
gtcacaaactacggatgcagcataaaggtgattccaggcaattctctttatatccgctta
aaatttgataccggtatatacgacgatgtttttatgaagaatatcgaaacatttttacgg
catatggtgaactcagtcatttccgaccctgaaatcggcgcttccgagatcgcattgctg
gatgcgtgtgaagccagaagtatgatggatgcatttaaccatacagaagcggttgaaccg
ccggctccgacgcttcacgggctgtttgcccgccgcgccgcgctttcgccgcatcgtccg
gcgctccgttttccgggcggtatgctgacgtacgccgagctcgatcagtacacggacagg
ctcgccgtccggctccgacaaaaaggcgtccgcaaagaaagcatggtcggcgtactcgct
gaacgttcgccggagatggttgtttcagtacttgccgtgttaaaagcgggcggcgcctac
gtgccgcttgacccggactatcctgaggacaggctgcgatatatgcttgaggacagcggc
gcttgtctcctgcttgcacagccgggattatccgttcccggtttttccggagaaacgcta
gaagtgtctctttccgctctgacaggcgagacggagacaggggctgtctctgacgaagcg
gatgctgattcgctcgcttatatcatttatacgtccggttcgacgggaacaccgaaggga
gtagctgttgaacaccgtcaggccgccgcctttttatcagggatgcaagggcagtttccg
ttaacggaagaggatgttatcgtgctgaaatcatccttttcattcgacgcctccatctgg
caattgttttggtggacgatgtcaggcgcctccgtgtatctgcttcctgccggctgggag
aaagatcctgtgcggatgattgaagcgtttgcctcagaaaaggtgacgaccgcgcatttt
attccggcgatggtcaacagctttttagacgcgctggaaacagtgcctgcggaaacaaga
gcacgcctcggcagaacactgacacgcgtgttcgccggaggggaagctctttccccgctt
acggcagcccggtttgccgatcttctgccggagaccatgcttattcacggctatggaccg
acggaagcgacggttgatgcggcgttttacgtctgtgaccgaaaacgggacagcggacgg
acaaggcttccgatcggaaaacctgttcctggtgcccgtctgtatgtattagatagcgga
ggaaccatccagcctgcgggcgtggcaggagagctgtacatcgcgggaaccggcgtggcc
cggggctatctgaaccggcctgagctgacggaggagcgctttgtcgatgatccgttttat
ccgggagaacgcatgtatcagacgggcgatatcgcacgctggacagaagacggccttgtt
gaatggctcgggcgttcagacggacaagtgaaagtccgcggctaccggattgaacccgga
gagattgaagcggcgatccggcgcatcgacggcattcgtgaggcggcggtcaccgcccgg
accgaacacggcgaaaccgcgctttacgcctatattgaaggacgaaaaagcgatgacgtg
cgggcggagcttgcggcacgccttccggcctacatgatgccggctcagttcataaagatg
accgaatggccggtcacgccgagcggaaagcttgaccgccgcgcgctgccggctcccggc
ggatcggcagacagacagacgtacaccgccccgcggaacgtcacggaaatgaagctttgc
gccctttgggaagaggtgctgaaaaacggccccgtcggcatccgggatcacttttttgag
cggggcggccattcgttaaaagcgacggctctcgtctcccgcatcgccaaagagttcggt
gttcaggtgccgttacaggacatcttcgcccggccgacggtggaagagctcgcttcggtt
attcaggacttggaagaaagcccgtatgaagcgattcagcctgcgaaaaaacaggacacc
tacccggtgtcttcggcgcagaaacggatgtatgtgctccaacagcttgaagacggcggt
gtcggctacaatatgccggctgtgctggaactgacgggcccgcttgaccgcagccggctg
gaggagacgttccggcagcttgtggagcggcacgagtcgctcagaacgtcctttgaaacg
gggcctgacggcgaaccggtgcagcgcatccatgacagcgtaccgtttcagctcgatgag
gccgagtcagctgacgcattcgtccggccgttttgtctggaagaagcgccgctcttccgt
gcggctctcgtgaaagaatcagacgaacgtcaccttttattaacggatatgcatcatatt
atttctgacggtgtgtccgtcaacaccttgataaaagaattcggcgagctgtacgcaggc
cgttcgcttgcgccgatgcgccttcaatataaagactatgccgtctggcagcggtcgttt
caggagaaagaaggataccagaagcaggaagcctattggctgaagcggcttgaaggagag
cttccggtgcttgaacttccggctgacaagccccgtccggcggtcagaagctttgcgggc
ggcagcgtatcgtgcacgcttgacgctgacacggcatccggccttcaccgcatcgcccgg
gatcacggctccactttgtatatggtgcttctcgccgcgtacaatacgttactcgcgcga
ttgagcgggcaggaagacatcatcgtcggatcgccgattgccgggcgcccgcacaaagac
cttgaaccgattctcggcatgttcgtcaacacgcttgccatcagaacggagccgaaagga
gacaaacggtttaccgattatttggcggaagtccgccaggcggcgcttgaggcgtatgaa
catcaggactacccgtttgaagagcttgtggagcggctcggcgtgcagcgggacatgagc
cgcaatccgctgtttgacgtgatgtttgtgctccaaaatatggagcgtgaatccctgaat
ttaaatgagctgcatttgactcaagccgcggatacaggtcataaaaccgcaaagtttgat
gccacgctttacgcggcggaagggtctgaaggttccatcagctttgattttgaattcaat
acagatatctatcaaaaacagacaatcgaaaaatggctttcttactttactcgtattctt
acaaaagtaattgaagaccaaacaataccgcttggtgacattcacgtactggatgatgct
gaaacaaatcgcgttatttatcagtttaatcagacgaaaagcgattacccaagacacgaa
accatcagccgtttatttgagcgtcaggctgaagaaacccccgatgcccgggcagtggta
tacgatggacaaatcttgacataccgtgagctgaacgaacgggctaacagaatagcggcg
gctctccgatcaaatggcgtcggtccggaaagtgttgtcgccttattaaccggacgtaca
acagagcttgcttccggaatcctcggaatattaaaagcgggaggcgcctacttgcctatc
ggtgacgatgtgcctcgggaacgggctgaatggatgcttaaagactgtaaagctgatatt
cttctccaatctgataaacttgacggtctgccgctttccggaaaacgtttattcatagag
gatattcaaacaaaggccggcttaagttcggaaaatcccgaaccgctcggcggacctgaa
tcattggcctacatgatttatacatccgggtcaacaggtgcgccaaaaggcgtcatgatt
gaacagcgaagcgtgatccgtcttgtgaaaaacagcaattatattgattttacgccgaaa
gacagactgttgtttacttcatcattaggatttgatgtaacgacatttgaaatattcggt
ccgcttttaaacggcgcttctttatatgtaagtgaccaggaaacctatctcgactctgat
attctggaaacatttatacagcaaaacggcattacgacactgtggctgacatcgtctttg
ttcaatcatctatcagaacaaaatgaacacgtgttttccggattatcccgattgattatc
ggcggggaagcactgtccccaagtcatgtaaaccgggttcggaaaacgctgccgcatctt
tcaatatggaatggatacggaccgactgaaaacacgacgttctcgacttgctttttgatt
gaacaatcatacgatcattcaatcccgatcggccgccctgtcggaaattcaactgcatat
atcataaacagcaggggaacaccgcagccgatcggcgtcatcggcgaattatgcacaggc
ggagacggtgtggcaagaggatatttcggccgccctgagctgacggaagaaaaatttgtc
cctaatccttttgttccgggagaacggatgtaccgcaccggagatttagcccgctggctg
ccggacggaacgattgaatatgccggacggatggatgatcaagtgaaaatccgcggttat
cgggtcgagctgggagagattgaagccgcactaaggagcttggacggcgtgaaagaagct
gccgtgtcagtcagaaccgggcagtccggcaataaagaactgatcgcatatatgagtctg
cagacggacatggatacagaaaaagtgcgttcatcactttctaagcaactgccgaattac
atggtcccggcctatatgatggaacttgagaagctgccgcttacgccgaacggtaaattg
gatcggaaaaatctgcccgaaccggtgctcgtgcttcaaaccgcgtacacagctccccgc
aatgagcttgaagaacagctttccgtgatctggcaggaagtgctcggcacaaaacaagtc
gggattgaggactcattttttgagttgggcggcgattcaatcaaagcgctgcaagttgcc
gcgcggctcggacgctacgggtggaaaatgacggcaagtgacttattccggcatccgtcc
attaaggaactcgcgcctcttatccggaaagcggaaagagtcatcgatcagcggccggtg
gaaggagacataccttggacacccgttcagcactggtttttatcacagcggatggaaaac
agaaatcatttcaatcagtccgtcatgatgttcagctctgacgcattgcataaacagccg
ctcaaacaagccttggagcatcttgtcattcatcatgatgcactccggatcaccgtcagt
tcagaaaacgaaagtatcagacaaatcaatcacggtattcaaaaagatgaactgtacagc
ttggacatttgggatctgtctgagacagatacttgggaaagagaaatagaagatgaagtg
gctgcgctccaacagcggatggatattgaaaaagggccgttattaaaagccggctggttc
aaaacccggtcaggggattatttattcatcaccgtacatcacctggcggttgacggagtg
tcatggcgtattctgctggaggatttatctgccgcttacactcatgccgtaaaaggtcag
ccggtccagcttccgccaaagaccgattcgtttaagcaatacgccgtaaggctttcagaa
tacgcaaaaagcagcaagctgatgcgtgaagaagaatattggcgttttattgaagaagaa
acagccgccggacttccttatgaaaaaccgcagcatcagacgggagccgacagcattcgg
caaacggtaagctttacacttacagaagaagaaacgtccgttttgcttcagcaggtcaac
cgggcataccataccgatacgcaagatattcttctgactgccgcagctttggctttacgg
gactggacagggggcggcagactgcgcatcgcgatggaagggcacgggagagagcacatc
atgccggagctcgacatcagccgcaccgtaggctggtttacctccatgtacccggtgctc
attgacttgaacacagcaggcgctgagcttggaacggctgtaaaaacggtcaaagacaca
ctcggaagaataccggataaaggaataggctacggcattttaaaatacatgacaccgcct
gaacaaaaaacaatccgcttcagacaagcgcctgaaatcagttttaactatttagggcaa
ttcaatgatacagaagagcagcacacattcagtttatccggtcttgcgagcgggcacgac
atcacgccgacatggcagcgggaacaagcggtggaaatgagcgcgatggccgctcaacat
aaactgcacttcagtttgagctatccgccgagccgcttccgcaaagaaacgatggaacag
ctgctgcaaaccttacagcaatatttgcgtgatattatggcgcactgcacaggcaaagag
gaagcagaaaaaaccgttagtgattttagcagcaaaacgttaacatctgatgatttggac
agcatagcgagttttgtcgaggaactgtag

DBGET integrated database retrieval system