KEGG   Bacillus amyloliquefaciens IT-45: KSO_010245
Entry
KSO_010245        CDS       T02462                                 
Name
(GenBank) Cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
bami00780  Biotin metabolism
bami01100  Metabolic pathways
bami01240  Biosynthesis of cofactors
Module
bami_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bami00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    KSO_010245
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bami00199]
    KSO_010245
Enzymes [BR:bami01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     KSO_010245
Cytochrome P450 [BR:bami00199]
 Cytochrome P450, bacteria type
  CYP107 family
   KSO_010245
SSDB
Motif
Pfam: p450 HU-CCDC81_euk_2
Other DBs
NCBI-ProteinID: AGF27544
LinkDB
Position
1988858..1990054
AA seq 398 aa
MTAGLSTAHPSLHADSDFWNDPYPFYEKLRAIDPVYKGTVLKHPGWYVTGYKEAAAILKD
TRFKNRVPFPEASTKYQNLSHIQHDMLLFKNQSDHKRMRMLIGKEFTAKTAESLRPCIKE
TVHDLLDQIQNKKNADLVSEFAFPLASLIIAEILGVPKDERYQFRQWTADVIQAIDLTRS
RKMLVRASDTAGRLTAYFRDLIHERKAHPQEDLISRFIMGEQLSKDEVLATCILLVIAGH
ETTVNLMSNGVFTLLKHPEQLSALRENPSLIETAVEECLRYDSPAQLTARTASEDCEING
KTIKKGEQVYILLGAANRDPSIFDQPHKMDIQRKPNPHLAFGKNAHFCIGSSLARIEAQI
AILTLFERMPKLRLAAHRLEYRKLIGFRSLKELPVVLG
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgacggcgggcctatcgactgcacatccgtccctccatgcggattcggatttttggaat
gacccttacccgttttatgaaaaactgcgtgccattgatcctgtttataaaggaaccgta
ttaaaacatccgggctggtatgtcaccgggtataaagaagcggcagcgattttgaaagac
acccggtttaaaaaccgcgtcccttttccggaagcttcaacgaaatatcaaaatctatcg
catatccagcacgatatgctgttatttaaaaatcaatcagaccataagcggatgcggatg
cttataggtaaagaatttaccgcaaagacggcggaatcacttcgcccctgtataaaagaa
acggttcatgacttgttggatcaaatccaaaacaaaaaaaacgcagaccttgtttcagag
tttgcctttccattggcaagcctcatcattgcggagatactcggagtgccgaaagatgag
agatatcaattcagacaatggacggcagacgtcattcaggccattgatcttacccggtca
agaaagatgttagtcagagcaagcgacaccgcaggcaggctgactgcttatttcagagat
ttgattcacgagcggaaagcacatcctcaggaagacttaatcagcaggtttattatgggg
gaacagctttcaaaagacgaagtgctcgcgacatgtatcttacttgtcatagccggacac
gagacgacggtaaacctcatgagcaacggtgtgtttactttattgaaacaccctgaacag
cttagcgcactgagagaaaacccctcgcttattgaaactgctgtcgaggaatgtctgcgc
tacgacagccccgcgcagctgacggcacgcaccgcttcagaagactgtgaaataaatggg
aagaccataaaaaaaggagagcaggtatatatccttttaggggcagccaatcgcgatcca
agcatattcgatcagcctcataaaatggacatccaaagaaaaccgaatccgcatcttgca
ttcggaaagaacgcccatttttgcataggctcctcattagcgcgcatcgaagcacaaatt
gcaattctcacactgtttgagcggatgcctaagcttcggctggccgcacaccgccttgaa
taccggaagctcattggttttaggtcgctcaaagagcttccggttgtccttggctga

DBGET integrated database retrieval system