KEGG   Bacillus amyloliquefaciens IT-45: KSO_014190
Entry
KSO_014190        CDS       T02462                                 
Name
(GenBank) Basic membrane protein A2 Immunodominant antigen P39
  KO
K05519  transcriptional activator of comK gene
Organism
bami  Bacillus amyloliquefaciens IT-45
Brite
KEGG Orthology (KO) [BR:bami00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bami03000]
    KSO_014190
Transcription factors [BR:bami03000]
 Prokaryotic type
  Other transcription factors
   Others
    KSO_014190
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: AGF28327
LinkDB
Position
complement(2854701..2855654)
AA seq 317 aa
MITRLVMIFSVLLLLSGCTQTPFKGKIEKVGMLFPDTISDLVWGTKGYKGLLAIQSEFNV
DVYYKENIRSDEDILKAIDDFHKKGVNLLYGHGNEYEEIFNMISKDYPDMEFVVANGTAK
SDNVTSVHLMGEAMGFFGGMTAAHMSKTNEVGVIASFLWQPEVDGFIKGAKYEKPDITVN
TEFTDHWDNGNEALHLYEKLKAEGTDVVYPAGDGYNVPVIQQIKKDGLYAIGYVAEQSNL
GKNTVLTSTVQNVDKAYTLIAEQYNKGTLKSGDHDFDFREGVVEMGTFSPLVDKAFQDKI
SDLVKTYNQTNELPSNE
NT seq 954 nt   +upstreamnt  +downstreamnt
ttgatcaccaggcttgtcatgatcttttctgtcctccttttattgagcggatgcacacaa
actccgtttaaaggaaaaattgagaaggtcggaatgcttttccccgataccatcagtgac
ttggtatggggcacaaaaggttacaaaggtttattagcgatacaatctgaatttaacgtt
gacgtttattataaagaaaatatcagatccgatgaagatattttaaaagcgatagatgat
tttcataaaaaaggagtcaatcttttatacgggcacggaaatgaatacgaggaaatcttc
aatatgatcagcaaggattatcccgacatggaattcgtcgtcgcaaacggaacggcgaaa
agcgataatgtcacaagcgttcaccttatgggagaagcaatgggttttttcgggggaatg
acggccgcccatatgtcaaaaaccaatgaggtcggtgtcatcgcctcttttctgtggcag
cctgaagtagacggctttatcaaaggggcgaaatatgaaaagcctgatatcaccgtcaat
actgaatttacggaccactgggataacggcaatgaagcgctgcatctttacgagaagtta
aaagcggaaggcacggatgttgtatatccggccggagacgggtataatgttcctgtcatt
cagcaaatcaaaaaagacgggctttacgccatcggctatgtcgccgagcaatcgaatctc
ggcaaaaacacggtgctgacaagcacggtgcaaaacgtagataaagcctatacattaatt
gccgagcaatataataaaggtacgctcaagagcggagatcacgactttgatttcagggaa
ggagtcgttgaaatggggacgttcagcccgctggtggacaaagcgtttcaagacaaaatc
tcagaccttgtcaaaacgtataatcaaacaaatgaactgccgtcaaatgaatag

DBGET integrated database retrieval system