KEGG   Bacillus velezensis UCMB5036: BAM5036_1761
Entry
BAM5036_1761      CDS       T02480                                 
Symbol
bioI
Name
(GenBank) cytochrome P450 for pimelic acid formation for biotin biosynthesis
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
baml  Bacillus velezensis UCMB5036
Pathway
baml00780  Biotin metabolism
baml01100  Metabolic pathways
baml01240  Biosynthesis of cofactors
Module
baml_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:baml00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BAM5036_1761 (bioI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:baml00199]
    BAM5036_1761 (bioI)
Enzymes [BR:baml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     BAM5036_1761 (bioI)
Cytochrome P450 [BR:baml00199]
 Cytochrome P450, bacteria type
  CYP107 family
   BAM5036_1761 (bioI)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: CCP21800
LinkDB
Position
complement(1911259..1912455)
AA seq 398 aa
MTADLSIAHPSLHADSDFWNDPYPFYDKLRSSDPVYKGTVLKYPGWYVTGYKEAAAILKD
IRFKNRIPLPEASTKYQNLSHIQHDMLLFKNQSDHKRMRMLIGKEFTAKTAESLRPCIKE
TVHDLLDQVQIKKNADLVSEFAFPLASLIIAEILGVPKEERYQFRQWTADVIHAIDLTRS
RKTLVRASDTAGRLTSYFRDLIHKRKAHPQQDLISRFIMEEQLSKEEVLATCILLVIAGH
ETTVNLISNGVFTLLKHPEQLSALRENPSLIETAVEECLRYDSPTQLTARTASEDCEING
KTIKKGEQVYILLGAANRDPSIFDQSHKMDIQRKPNPHLAFGKNAHFCIGSSLARIEAQI
AILTLFERMPKLRLAAHRLEYRKLIGFRSLKELPVVIG
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgacggcggacctatcgattgcacatccgtctctccatgcggattcggatttttggaat
gacccttacccgttttatgacaaactgcgatccagtgatcctgtttataaaggaaccgta
ttaaaatatccgggctggtatgtcaccgggtacaaagaagcggcagcgattctgaaagac
attcggtttaaaaaccgcattcctcttccggaagcttcaacgaaatatcaaaatctatcg
catatccagcacgatatgctgttatttaaaaatcaatcagaccataaacggatgcggatg
cttatcggtaaagaatttaccgcaaagacggcggaatcacttcgcccctgtataaaagaa
acggttcatgacttgttggatcaagtccaaatcaaaaaaaacgctgaccttgtttcagag
tttgcctttccattggcaagccttatcattgcggagatactcggagtaccgaaagaggag
agatatcaattcagacaatggacggcagacgtcattcacgccattgatcttacccgatca
agaaagacgttagtcagagcaagcgacaccgcaggcaggctgacgtcatatttcagagat
ttgattcacaagcggaaagcgcaccctcagcaagacttgatcagcaggtttattatggag
gagcagctttcaaaagaggaagtgctcgcgacatgtatcttacttgtcatagccggacac
gagacgacggtaaacctcataagcaacggtgtgtttactttattgaaacaccctgaacag
cttagcgcactgagagaaaacccctcgcttattgaaactgcagttgaggaatgtctgcgc
tacgacagccccacgcagctgacggcacgcaccgcctcagaagactgcgaaataaatggg
aagaccataaaaaaaggagagcaggtatatatccttttaggtgcagccaatcgcgatcca
agcatattcgatcaatctcacaaaatggatatccaaagaaaaccgaacccgcatcttgca
ttcggaaagaacgcccatttttgcataggctcctcattagcgcgcatcgaagcacaaatt
gcaattctcacactgtttgagcggatgcctaagcttcggctggctgcacaccgccttgaa
taccgcaagctcattggttttaggtcgctcaaagagctcccggttgtcattggctga

DBGET integrated database retrieval system