KEGG   Bacillus velezensis UCMB5113: BASU_1799
Entry
BASU_1799         CDS       T02796                                 
Symbol
fenC
Name
(GenBank) FenC protein
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bamn  Bacillus velezensis UCMB5113
Pathway
bamn01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bamn00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    BASU_1799 (fenC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bamn01008]
    BASU_1799 (fenC)
Polyketide biosynthesis proteins [BR:bamn01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    BASU_1799 (fenC)
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: CDG26092
LinkDB
Position
complement(1948885..1956534)
AA seq 2549 aa
MGQQPEIQDIYPLSFMQEGMLFHSLLDHDSRAYFEQAVFTINGQLDRERFQKSIDAVFER
YDIFRTTFIHKNVAKPRQVVLKNRPSRVQFHDISHLDEKAQDKYTDRFRKEDKDKGFDLQ
SDPLMRVSILKKAPERYVCIWSHHHIVMDGWCFGIVMKEFLMIYQSLGDGRLPSLEPVQP
YGKYIKWLMKQDRKEAEIFWKTRLADLEQSASLPKKSAEPNGELEQAVFTISEEQTNELK
NIAARAGATLNTVFQALWGMLLQRVSRCDDAVFGSVVSGRPSDLAGVEKMVGLFINTIPV
RVKSGSFSFLELVRHLQQETLQAEAYSYYPLYDIQAQSPLKQALFDHIIVFENVPAQREI
ENVSQSGSFDFAVEDFTMEEVTNYGCSIKVIPGNSLYIRLNFDTGIYDSVFMKNIETFLR
HMMNSVISDPEICASEIALLDAREARSMLDAFNRTETVEPPAPTLHGLFTRRAALSPHRP
ALRFPGGMLTYAELDQYTDRLAVWLRQKGVRKESMVGVLAERSPEMVVSVLAVLKAGGAY
VPLDPEYPEDRMRYMLDDSGACLLLAQPGLSVSGFSGETLEVSLSALTGETETGAVSEEA
DSDSLAYIIYTSGSTGTPKGVAVEHRQAAAFLSGMQGQFPLTEEDIIVLKSSFSFDASIW
QLFWWTMSGASVYLLPAGWEKDPVRMIEAFASEKVTTAHFIPAMVNSFLDALETEPAETR
TRLGRTLTRVFAGGEALSPLTAARFADLLPETVLIHGYGPTEATVDAAFYVCDRKRDSGR
TRLPIGKPVPGARLYVLDSGGTIQPAGVAGELYIAGTGVARGYLNRPELTEERFLDDPFY
PGERMYQTGDIARWTEDGLVKWLGRSDGQVKVRGYRIEPGEIEAAIRRIDGIREAAVTAR
TEHGETALYAYIEGRESDDVRAELATRLPAYMMPAQFIEMSEWPVTPSGKLDRRALPAPG
GAADRQAYTAPRNVTEMKLCALWEEVLKNGPVGIRDHFFERGGHSLKATALVSRIAKEFG
VQVPLQDIFARPTVEELASVIQDLEESPYEAIQPAQKQDTYPVSSAQKRMYVLQQLEDGG
VGYNMPAVLELTGPLDRIRLEETFRELVERHESLRTSFETGPDGEPVQRIHDSVPFQLDE
AESADAFVRPFCLEEAPLFRAALVKESDERHLLLTDMHHIISDGVSVNTLIKEFGELYAG
RSLAPMRLQYKDYAVWQRSFQEKEGYQKQEAYWLKRLEGELPVLELPADKPRPAVRSFAG
GSVSCTLDAETASGLHRIARDHGSTLYMVLLAAYNTLLARLSGQEDIIVGSPIAGRPHKD
LEPILGMFVNTLAIRTEPKGGKRFTDYLAEVRQAALEAYEHQDYPFEELVERLGVQRDIS
RNPLFDVMFVLQNMERESLVLNKLHLAQAADTSHKTAKFDATLYASEGSDGSISFDFEFN
TDIYQKQTIEKWLSYFTRILTKVIENQAIPLGDIHVLDDAETNRVIYQFNQTKSDYPRHE
TISRLFERQAKETPDARAVVYDGQILTYRELNERANRIAAALRSNGVGPESVVALLTGRT
TELASGILGILKAGGAYLPIGDDVPRERAEWMLKDCKADILLQSDKLDGLPLSGKRLFIE
DIQTKAGLSSENPEPLGGPESLAYMIYTSGSTGAPKGVMIEQRSVIRLVKNSNYIDFTPE
DRLLFTSSLGFDVTTFEIFGPLLNGASLYVSDQETYLDSDVLETFIQQNGITTLWLTSSL
FNHLSEQNEHVFSGLSRLIIGGEALSPSHVNRVRNALPHLSVWNGYGPTENTTFSTCFLI
EQSYDHSIPIGRPVGNSTAYIINSRGTPQPIGVIGELCTGGDGVARGYFGRPELTEEKFV
PNPFVPGERMYRTGDLARWLPDGTIEYAGRMDDQVKIRGYRVELGEIEAALRSLDGVKEA
AVSVRTGQSGNKELIAYMSLQADMDTEKVRSSLSKQLPNYMVPAYMMELEKLPLTPNGKL
DRKNLPEPQLALQTAYTAPRNELEEQLSVIWQEVLGTKQVGIEDSFFELGGDSIKALQVS
ARLGRYGWKMTASDLFRHPSIKELAPLIRKAERVIDQRPVEGDIPWTPVQHWFLSQRMEN
RNHFNQSVMMFSSDALHKQPLKEALEHLVIHHDALRITVSAENESFRQINHGIQKDELYS
LDIWDLSETDTWEKEIESEVAALQQRMDIEKGPLLKAGWFKTRSGDYLFITVHHLAVDGV
SWRILLEDLSAAYTQAVKGQPVQLPPKTDSFKQYAERLSKYAKSSKLMREEEYWRFIEEE
TAAELPYEKPQHQTGADSIRQTVSFTLTEEETSVLLQQVNRAYHTDTQDILLTAAALALR
DWTGGGRLRIAMEGHGREHIMPELDISRTVGWFTSMYPVLIDLNTAGAELGTAVKTVKDT
LGRIPDKGIGYGILKYMTPPEQKTIRFRQAPEISFNYLGQFNDTEDQHTFSLSGLASGHD
ITPTWQREQAVEMSAMAAQNKLHFSLSYPPSRFRKETMEQLLQTLQQYLRDIMAHCTGKE
EAEKTVSDFSSKTLTSDDLDSIASFVEEL
NT seq 7650 nt   +upstreamnt  +downstreamnt
atggggcagcaaccggaaatacaagatatatatcctttatcttttatgcaggagggcatg
ctttttcattctctgttggatcatgactcaagagcctacttcgaacaagcggtgtttacg
atcaacggacagcttgaccgggaacgattccaaaaaagtatagatgctgtttttgaacga
tacgatattttccgtacgacatttattcataagaatgtggcgaagccccgccaagtcgtg
ttgaaaaacaggccgagccgcgttcagtttcatgatatttctcatttggacgagaaggca
caagacaaatataccgaccgattcagaaaagaagataaagataaaggctttgatttgcaa
tcagaccctctcatgagagtctccattttgaaaaaagcgcctgaacgctatgtttgtatc
tggagccatcatcatatcgtcatggacggctggtgcttcggaattgtcatgaaggaattt
ctgatgatctatcaatctctcggagacgggcggctcccgtctctcgagcctgttcagcca
tatggaaagtatatcaaatggctcatgaagcaggatcgtaaagaagccgagattttttgg
aaaacgagacttgccgatcttgagcaatcggcgtctcttccgaaaaaatccgcggaacca
aatggcgaacttgagcaggcggttttcaccatttctgaagagcagacaaatgagctgaag
aacattgcggcaagggcgggagcaacgctgaatacagtgttccaggcactgtggggcatg
ttgctgcagcgtgtcagccgctgtgatgacgccgttttcggttctgtcgtttccggccgg
ccgtcggatctcgcaggcgtggaaaaaatggtgggactgtttattaatacgattcccgtg
cgggtgaaaagcggttcattttcttttctggagctcgtcaggcatttgcagcaggagacg
ctgcaagcagaagcgtacagctattatccgctgtatgacattcaagcgcaaagccctttg
aagcaagcgctgtttgaccacattatcgtgtttgaaaatgtgccggcccagcgtgaaatt
gaaaatgtgagtcagtccggttcatttgattttgcggtagaagatttcacgatggaggaa
gtcacaaactacggatgcagcataaaggtgattccgggaaattctctttatatccgctta
aactttgataccggtatatacgacagcgtttttatgaagaatatcgaaacatttttacgg
catatgatgaattcagtcatctccgatcctgaaatttgcgcctccgagatcgcattgctt
gatgcgcgtgaagccagaagtatgctggatgcgtttaaccgtacagaaacggttgaaccg
ccggctccgacgcttcacgggctgttcacccgccgtgccgcgctttcgccgcatcgtccg
gcgctccgttttccgggcggtatgctgacgtacgccgagcttgaccagtacacagacaga
ctcgctgtttggctccgccaaaaaggcgtccgcaaagaaagcatggtcggcgtgctcgct
gaacgttcgccggagatggtggtttcagtgcttgctgtgttaaaagcgggcggcgcctac
gtgccgcttgacccggagtatcctgaggacaggatgcgctatatgctcgatgacagcggg
gcttgtctcctgcttgcacagccgggattatccgtttccggtttttccggagaaacgcta
gaagtgtctctttctgctctgacaggcgagacggagacaggggctgtctctgaagaagcg
gatagcgattcgctcgcttatatcatttatacgtccggttcgacgggaacaccgaaggga
gtagctgttgaacaccgtcaggccgccgcctttttatcagggatgcaagggcagttcccg
ttgacagaagaggatattatcgtgctgaaatcatccttttctttcgacgcttccatctgg
caattgttttggtggacgatgtccggcgcctccgtgtatctgcttcctgccggctgggag
aaagatcctgtgcggatgattgaagcgtttgcctcagaaaaggtgacgaccgcgcatttt
attccggcgatggtcaacagctttttagatgcgctggaaacagagcctgcggaaacaaga
acacgcctcggcagaaccttgacacgcgtgtttgccggaggggaagctctttcaccgctt
acggctgcccggtttgccgatcttctgccggagaccgtgctcattcacggctacgggccg
acggaagcgacggtggatgcggcgttttacgtctgtgaccgaaaacgggacagcggacgg
acgcggcttccgattggtaaacccgttccgggtgcccgtctgtatgtattagatagcgga
ggaaccatccagcctgcgggcgtggcaggagagctgtacatcgcggggacaggggtggcc
cggggctatctgaaccggcccgagctgacggaggagcgttttctcgatgatccgttttat
ccgggagagcgcatgtatcagacgggcgatatcgcacgctggacagaagacggcctagtc
aaatggctcggacgttcagacggacaggtgaaagtccgcggctaccggattgaaccggga
gaaatcgaagcggcgatccggcgcatcgacggcattcgtgaggcggcggtcaccgcccgg
accgaacacggcgaaaccgcgctttacgcctatatcgaaggacgggaaagcgatgacgtg
cgggcggagcttgcgacacgccttccggcctacatgatgccggctcagtttatagagatg
agcgaatggccggtcacgccgagcggaaagcttgaccgccgcgcgctgccggctcccggc
ggagcggcagacagacaggcgtacaccgccccgcggaacgtcacggaaatgaagctttgc
gccctttgggaagaggtgctgaaaaacggccccgtcggcatccgggatcacttttttgag
cggggcggccattcgttaaaagcgacggctctcgtctcccgcatcgccaaagagttcggt
gttcaggtgccgttacaagacatcttcgcccggccgacggtggaagagctcgcttcggtc
attcaggacttggaggagagcccgtatgaagcgattcagcctgcgcaaaaacaggacacc
tacccggtgtcttcggcgcagaaacggatgtatgtgctccagcagcttgaagacggcggt
gtcggctacaatatgccggctgtgctggaactgacgggcccgcttgaccgcatccggctg
gaggagacgttccgggagcttgtggagcggcatgagtcgctcagaacgtcctttgaaacg
gggcctgacggcgaaccggtgcagcgcatccatgacagcgtaccgtttcagctggatgag
gccgagtcagctgacgcattcgtccggccgttttgtctggaggaagcgccgctcttccgt
gcggccctcgtgaaagaatcggacgaacgtcatcttttattaacggatatgcatcatatt
atttctgacggtgtgtccgtcaacaccttgattaaagaattcggcgagctgtacgcaggc
cgttcgcttgcgccgatgcgccttcaatataaagactatgccgtctggcagcggtcgttt
caggagaaagaaggatatcagaagcaggaagcctattggctgaagcggcttgaaggagag
cttccggtgcttgagcttccggctgacaagccccgtccggctgtcagaagctttgcgggc
ggcagcgtatcgtgcacgcttgacgctgaaacggcatccggccttcaccgcattgcccgg
gatcacggctccactttgtatatggtgcttctcgccgcgtacaatacgttactcgcgaga
ttgagcgggcaggaagacatcatcgtcggctcgccgattgccgggcgtccgcacaaagac
cttgaaccgattctcggcatgttcgtcaacacgctcgccatcagaacggagccgaaagga
ggcaaacggtttactgattatttggcggaagtccgccaggccgcgcttgaggcgtatgaa
catcaggactatccgtttgaagagctagtggaacggcttggcgtgcagcgggacataagc
cgcaatccgctgtttgatgtgatgtttgtgctccaaaatatggagcgtgaatccctggtg
ttaaataagctgcatttggctcaagctgcggatacaagtcataaaaccgcaaagtttgat
gccacgctttacgcgtcagaagggtctgacggttccatcagctttgattttgaattcaat
acagatatctatcaaaaacagacaattgaaaaatggctttcttattttacccgtattctt
acaaaagtaattgaaaaccaagcgataccgcttggtgacattcacgtactggatgatgct
gaaacaaatcgcgtcatttatcagtttaatcagacgaaaagcgattacccaagacacgaa
accatcagccgtttatttgagcggcaggcaaaagaaacccccgatgcccgggcagttgta
tatgatggacaaatcttgacataccgtgagctgaacgaacgggctaacagaatagcggcg
gctctccgatcaaatggcgtcggtccggaaagcgttgtcgccttactaaccggccgcaca
acagagcttgcctccggaatcctcggaatattaaaagcgggaggcgcctacttgcctatc
ggtgacgatgtgccgcgggaacgggctgaatggatgcttaaagactgtaaagctgatatt
cttctccaatctgataaacttgacggtctgccgctttcaggaaaacgtttattcatagag
gatattcaaacaaaggccggcttgagttcggaaaatcccgaaccgctcggcggacctgaa
tcattggcctacatgatttatacgtccggatcaacaggtgcgccaaaaggcgtcatgatt
gaacagcgaagcgtgatccgccttgtgaaaaacagcaattatattgattttacgccggaa
gatagactgttgtttacttcatcattaggatttgacgttacgacatttgaaatattcggt
ccgcttttaaacggcgcttctttatatgtaagtgaccaggaaacctatctcgactctgat
gttctggaaacatttatacagcaaaacggcattacgacactgtggctgacatcgtctctg
ttcaaccatttatcagaacaaaatgaacacgtgttttccggattatcccgattgattatc
ggcggggaagcactgtccccgagccatgtaaaccgggttcggaatgcgctgccgcatctc
tcagtatggaatggatacggaccgactgaaaacacgacgttctcgacttgctttttgatt
gaacaatcatacgatcattcaatcccgatcggccgccctgtcggaaattcaaccgcatat
atcataaacagcaggggaacaccgcagccgatcggcgtcatcggcgaattatgcactgga
ggagacggtgtggcaagaggatacttcggccgccctgagctgacggaagaaaaattcgtc
cccaatccttttgttccaggagaacggatgtaccgcaccggagatttagcccgctggctg
ccggacggaacgatcgaatatgccgggcggatggatgatcaagtgaaaatccgcggttat
cgggtcgagctgggagagattgaagccgcactgaggagcctggacggcgtgaaagaagct
gccgtgtcagtcagaaccgggcagtccggcaataaagaactgatcgcatatatgagtctg
caggcggacatggatacagaaaaagtgcgttcttcactgtctaagcaactgccgaattac
atggttccggcctatatgatggaacttgagaagctgccgcttacgccgaacggtaaattg
gatcggaaaaatctgcccgaaccgcagctcgcgcttcaaaccgcgtacacagctccccgc
aatgagcttgaagaacagctttccgtgatctggcaggaagtgctcggcacaaaacaagtc
gggattgaggactcattttttgagttgggcggcgattcaatcaaagcgctgcaagtttcc
gcacggctcggacgctatgggtggaaaatgacggcaagcgacttattccggcatccgtcc
attaaggagctcgcgccacttatccggaaagcggaaagagtcatcgatcagcggccggtg
gaaggagacataccttggacacccgttcagcactggtttttatcacagcggatggaaaac
agaaatcatttcaatcagtccgtcatgatgttcagctctgacgcattgcataaacagccg
ctcaaagaagccttggagcatcttgtcattcatcatgatgcactccggatcaccgtcagt
gcagaaaacgaaagtttcagacaaatcaatcacggtattcaaaaagatgaactgtacagc
ttggacatttgggatctgtctgagacagatacttgggaaaaagaaatagaaagtgaagtc
gctgcgctccaacagcggatggatattgaaaaaggcccgttattaaaagccggctggttc
aaaacccggtccggggattatttattcatcaccgtacatcacctggcggttgacggagtg
tcatggcgtattttgctggaggatttatctgccgcttacactcaagccgtaaaaggtcag
ccggtccagcttccgccaaagaccgattcgtttaagcaatacgctgaaaggctttcaaaa
tacgcaaaaagcagcaagctgatgcgtgaagaagaatattggcgttttattgaagaagaa
acagccgccgaacttccttatgaaaaaccgcagcatcagacgggagccgacagcattcgg
caaacggtaagctttacgcttacagaagaagaaacgtccgttttgcttcagcaggtcaac
cgggcctaccataccgatacgcaagatattcttctgactgccgcagctttggctttacgg
gactggacagggggcggcagactgcgcatcgcgatggaagggcacgggagagagcacatc
atgccggagctcgacatcagccgcaccgtaggctggtttacctccatgtatccggtgctc
attgacttgaacacagcaggcgctgagcttggaacggcggtaaaaacggtcaaagacaca
ctcggaagaataccggataaaggaataggctacggcattttaaaatacatgacaccgcct
gaacaaaaaacaatccgcttcagacaagcgcctgaaatcagctttaactatttagggcaa
ttcaatgatacagaagatcagcacacgttcagtctgtccggtcttgcaagtgggcacgac
atcacgccgacatggcagcgggaacaagcggtggaaatgagcgcgatggccgcacaaaac
aaacttcacttcagtttgagctatccgccgagccgcttccgcaaagaaacgatggaacag
ctgctgcaaactttacagcaatatttgcgtgatattatggcgcactgcaccggcaaagag
gaagcagaaaaaaccgttagtgattttagcagcaaaacgttaacatctgatgatttggac
agcatagcgagttttgtcgaggaactgtag

DBGET integrated database retrieval system