KEGG   Bacillus velezensis TrigoCor1448: AJ82_06355
Entry
AJ82_06355        CDS       T03161                                 
Name
(GenBank) transcriptional regulator
  KO
K05519  transcriptional activator of comK gene
Organism
bamt  Bacillus velezensis TrigoCor1448
Brite
KEGG Orthology (KO) [BR:bamt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bamt03000]
    AJ82_06355
Transcription factors [BR:bamt03000]
 Prokaryotic type
  Other transcription factors
   Others
    AJ82_06355
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: AHK48681
LinkDB
Position
1131012..1131965
AA seq 317 aa
MITRLVMIFSVLLLLSGCAQTPFKGKIEKVGMLFPDTISDLVWGTKGYKGLLAIQSEFNV
DVYYKENIRSDEDILKAIDDFHKKGVNLLYGHGNEYEEIFNMISKDYPDMEFVVANGTAK
SDNVTSVHLMGEAMGFFGGMTAAHMSKTNEVGVIASFLWQPEVDGFIKGAKYEKPDITVN
TEFTDHWDNGNEALHLYEKLKAEGTDVVYPAGDGYNVPVIQQIKKDGLYAIGYVAEQSNL
GKNTVLTSTVQNVDKAYTLIAEQYNKGTLKSGDHNFDFREGVVEMGTFSPLVDKAFQDKI
SDLVKTYNRTNELPSNE
NT seq 954 nt   +upstreamnt  +downstreamnt
ttgatcaccaggcttgtcatgatcttttctgtcctccttttattgagcggatgcgcacaa
actccgtttaaaggaaaaattgagaaggtcggaatgctttttcccgataccatcagtgac
ttggtatggggcacaaaaggttacaaaggtttattagcgatacaatctgaatttaacgtt
gacgtttattataaagaaaatatcagatccgatgaagatattttaaaagcgatagatgat
tttcataaaaaaggagtcaatcttttatacgggcacggaaatgaatacgaggaaatcttc
aatatgatcagcaaggattatcccgacatggaatttgtcgtcgcaaacggaacggcgaaa
agcgataatgtcacaagcgttcatcttatgggagaagcaatgggttttttcgggggaatg
acagccgcccatatgtcaaaaaccaatgaggtcggcgtcatcgcctcctttttgtggcag
cctgaagtagacggctttatcaaaggggcgaaatatgaaaagcctgatatcaccgtcaac
actgaatttacggaccactgggataacggcaatgaagcgctgcatctttacgagaagtta
aaagcggaaggcacggatgttgtatatccagccggagacgggtataatgttcctgtcatt
cagcaaatcaaaaaagacgggctttacgccatcggctatgtcgccgaacaatcgaatctc
ggcaaaaacacggtgctgacaagcacggtgcaaaacgtagataaagcctatacattaatt
gccgagcaatataataaaggtacgctcaagagcggagatcacaactttgatttcagggaa
ggagtcgttgaaatggggacgttcagccctctggtggacaaagcatttcaagacaaaatc
tcagaccttgtaaaaacgtataaccgaacaaatgaactgccgtcaaatgaatag

DBGET integrated database retrieval system