KEGG   Bacillus velezensis TrigoCor1448: AJ82_10365
Entry
AJ82_10365        CDS       T03161                                 
Name
(GenBank) cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bamt  Bacillus velezensis TrigoCor1448
Pathway
bamt00780  Biotin metabolism
bamt01100  Metabolic pathways
bamt01240  Biosynthesis of cofactors
Module
bamt_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bamt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AJ82_10365
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bamt00199]
    AJ82_10365
Enzymes [BR:bamt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     AJ82_10365
Cytochrome P450 [BR:bamt00199]
 Cytochrome P450, bacteria type
  CYP107 family
   AJ82_10365
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AHK49370
LinkDB
Position
complement(1954441..1955637)
AA seq 398 aa
MTADLSIAHPSLHADSDFWNDPYPFYDKLRSIDPVYKGTVLKYPGWYVTGYKEAAAILKD
TRFKNRIPLPEASTKYQNLSHIQHDMLLFKNQSDHKRMRMLIGKEFTAKTAESLRPCIKE
TVHDLLDQVQIKKTADLVSEFAFPLASLIIAEILGVPKEERYQFRQWTADVIQAIDLTRS
RKTLVRASDTAGRLTSYFRDLIHKREAHPQQDLISRFIMEEQLSKEEVLATCILLVIAGH
ETTVNLMSNGVFTLLKHPEQLSALRENPSLIETAVEECLRYDSPAQLTARTASEDCEING
KTIKKGEQVYILLGAANRDPSIFDQPHKMDIQRKPNPHLAFGRNAHFCIGSSLARIEAQI
AILTLFERMPKLRLAAHRLEYRKLIGFRSLKELPVVIG
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgacggcggacctatcgattgcacatccgtctctccatgcggattcggatttttggaat
gacccttacccgttttatgacaaactgcgatccattgatcctgtttataaaggaaccgta
ttaaaatatccgggctggtatgtcaccgggtacaaagaagcggcagcgattctgaaagac
acccggtttaaaaaccgcattcctcttccggaagcttcaacgaaatatcaaaatctatcg
catatccagcacgatatgctgttatttaaaaatcaatcagaccataagcggatgcggatg
cttatcggtaaagaatttaccgcaaagacggcggaatcacttcgcccctgtataaaagaa
acggttcatgacttgttggatcaagtccaaatcaaaaaaaccgcggatcttgtttcagaa
tttgcatttccattggcaagccttatcattgcggagatactcggagtgccgaaagaggag
agatatcaattcagacaatggacggcagacgtcattcaggccattgatcttacacgatca
agaaagacgttagtcagagcaagcgacaccgcaggcaggctgacgtcatatttcagagat
ttgattcacaagcgggaagcgcaccctcagcaagacttgatcagcaggtttattatggag
gaacagctttcaaaagaggaagtgctcgcgacatgtatcttacttgtcatagccggacac
gagacgacggtaaacctcatgagcaacggtgtgtttactttattgaaacaccctgaacag
cttagcgcactgagagaaaacccctcgcttattgaaactgcagttgaggaatgtctgcgc
tacgacagccccgcgcagctgacggcacgcaccgcctcagaagactgcgaaataaatggg
aagaccataaaaaaaggagagcaggtatatatccttttaggggcagccaatcgcgatcca
agcatattcgatcaacctcacaaaatggatatccaaagaaaaccgaatccgcatcttgca
ttcggaaggaacgctcatttttgcataggctcctcattagcgcgcatcgaagcacaaatt
gcaattctcacactgtttgagcggatgcctaagcttcggctggctgcacaccgccttgaa
taccgcaagctcattggttttaggtcgctcaaagagctcccggttgtcattggctga

DBGET integrated database retrieval system