KEGG   Bacillus velezensis SQR9: V529_10770
Entry
V529_10770        CDS       T03384                                 
Symbol
med
Name
(GenBank) Transcriptional activator protein med
  KO
K05519  transcriptional activator of comK gene
Organism
bamy  Bacillus velezensis SQR9
Brite
KEGG Orthology (KO) [BR:bamy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bamy03000]
    V529_10770 (med)
Transcription factors [BR:bamy03000]
 Prokaryotic type
  Other transcription factors
   Others
    V529_10770 (med)
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: AHZ15103
LinkDB
Position
1143971..1144924
AA seq 317 aa
MITRLVMIFSVLLLLSGCAQTPFKGKIEKVGMLFPDTISDLVWGTKGYKGLLAIQSEFNV
DVYYKENIRSDEDILKAIDDFHKKGVNLLYGHGNEYEEIFNMISKDYPDMEFVVANGTAK
SDNVTSVHLMGEAMGFFGGMTAAHMSKTNEVGVIASFLWQPEVDGFIKGAKYEKPDITVN
TEFTDHWDNGNEALHLYEKLKAEGTDVVYPAGDGYNVPVIQQIKKDGLYAIGYVAEQSNL
GKNTVLTSTVQNVDKAYTLIAEQYNKGTLKSGDHNFDFREGVVEMGTFSPLVDKAFQDKI
SDLVKTYNRTNELPSNE
NT seq 954 nt   +upstreamnt  +downstreamnt
ttgatcaccaggcttgtcatgatcttttctgtcctccttttattgagcggatgcgcacaa
actccgtttaaaggaaaaattgagaaggtcggaatgctttttcccgataccatcagtgac
ttggtatggggcacaaaaggttacaaaggtttattagcgatacaatctgaatttaacgtt
gacgtttattataaagaaaatatcagatccgatgaagatattttaaaagcgatagatgat
tttcataaaaaaggagtcaatcttttatacgggcacggaaatgaatacgaggaaatcttc
aatatgatcagcaaggattatcccgacatggaattcgtcgtcgcaaacggaacggcgaaa
agcgataatgtcacaagcgttcaccttatgggtgaagcaatgggctttttcgggggaatg
acggccgcccatatgtcaaaaaccaatgaggtcggcgtcatcgcctcctttttgtggcag
cctgaagtagacggctttatcaaaggggcgaaatatgaaaaacccgatatcaccgtcaat
actgaatttacggaccactgggataacggcaatgaagcgctgcatctttacgaaaagtta
aaagcggaaggcacggatgttgtatatccggccggagacgggtataatgttcctgtcatt
cagcaaatcaaaaaagacgggctttacgccatcggctatgtggccgagcaatcgaatctc
ggcaaaaacacggtgctgacaagcacggtgcaaaacgtagataaagcctatacattaatt
gccgagcaatataataaaggtacgctcaagagcggagatcacaactttgatttcagggaa
ggagtcgttgaaatgggaacgttcagccctctggtggacaaagcatttcaagacaaaatc
tcagaccttgtaaaaacgtataaccgaacaaatgaactgccgtcaaatgaatag

DBGET integrated database retrieval system