KEGG   Bacillus velezensis SQR9: V529_17940
Entry
V529_17940        CDS       T03384                                 
Symbol
bioI
Name
(GenBank) BioI
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bamy  Bacillus velezensis SQR9
Pathway
bamy00780  Biotin metabolism
bamy01100  Metabolic pathways
bamy01240  Biosynthesis of cofactors
Module
bamy_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bamy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    V529_17940 (bioI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bamy00199]
    V529_17940 (bioI)
Enzymes [BR:bamy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     V529_17940 (bioI)
Cytochrome P450 [BR:bamy00199]
 Cytochrome P450, bacteria type
  CYP107 family
   V529_17940 (bioI)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AHZ15820
LinkDB
Position
complement(1939782..1940978)
AA seq 398 aa
MTADLSIAHPSLHADSDFWNDPYPFYDKLRSIDPVYKGTVLKYPGWYVTGYKEAAAILKD
IRFKNRIPLPEASTKYQNLSHIQHDMLLFKNQSDHKRMRMLIGKEFTAKTAESLRPCIKE
TVHDLLDQVQIKKTADLVSEFAFPSASLIIAEILGVPKEERYQFRQWTADVIQAIDLTRS
RKTLVRASDTAGRLTSYFKDLIHKRKAHPQQDLISRFIMEEQLSKEEVLATCILLVIAGH
ETTVNLISNGVFTLLKHPEQLSALRENPSLIETAVEECLRYDSPAQLTARTASEDCEING
KTIKKGEQVYILLGAANRDPSIFDQPHKMDIQRKPNPHLAFGKNAHFCIGSSLARIEAQI
AILTLFERMPKLRLAAHRLEYRKLIGFRSLKELPVVIG
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgacggcggacctatcgattgcacatccgtctctccatgcggattcggatttttggaat
gacccttacccgttttatgacaaactgcgatccattgatcctgtttataaaggaaccgta
ttaaaatatccgggctggtatgtcaccgggtacaaagaagcggcagcgattctgaaagac
attcggtttaaaaaccgcattcctcttccggaagcttcaacgaaatatcaaaatctatcg
catatccagcacgatatgctgttatttaaaaatcaatcagaccataagcggatgcggatg
cttatcggtaaagaatttaccgcaaagacggcggaatcacttcgcccttgtataaaagaa
acggttcatgacttgttggatcaagtccaaatcaaaaaaaccgcggaccttgtttcagag
tttgcctttccatcggcaagccttatcattgcggagatactcggagtgccgaaagaggag
agatatcaattcagacaatggacggcagacgtcatccaggccattgatcttacccgatca
agaaagacgttagtcagagcaagcgacaccgcaggcaggctcacgtcatatttcaaagat
ttgattcacaagcggaaagcgcaccctcagcaagacttgatcagcaggtttattatggag
gaacagctttcaaaagaggaagtgctcgcgacatgtatcttacttgtcatagccggacac
gagacgacggtaaacctcataagcaacggtgtgtttactttattgaaacaccctgaacag
cttagcgcactgagagaaaacccctcgcttattgaaactgcagttgaggaatgtctgcgc
tacgacagccccgcgcagctgacggcacgcaccgcctcagaagactgcgaaataaatggg
aagaccataaaaaaaggagagcaggtatatatccttttaggggcagccaatcgcgatcca
agcatattcgatcaacctcacaaaatggatatccaaagaaagccgaacccgcatcttgca
ttcggaaagaacgcccatttttgcataggctcctcattagcgcgcatcgaagcacaaatt
gcaattcttacactgtttgagcggatgcctaagcttcggctggctgcacaccgccttgaa
taccgcaagctcattggttttaggtcgctcaaagagctcccggttgtcattggctga

DBGET integrated database retrieval system