KEGG   Bacillus velezensis SQR9: V529_18140
Entry
V529_18140        CDS       T03384                                 
Symbol
fenC
Name
(GenBank) FenC
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bamy  Bacillus velezensis SQR9
Pathway
bamy01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bamy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    V529_18140 (fenC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bamy01008]
    V529_18140 (fenC)
Polyketide biosynthesis proteins [BR:bamy01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    V529_18140 (fenC)
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: AHZ15840
LinkDB
Position
complement(1972796..1980445)
AA seq 2549 aa
MGQQPEIQDIYPLSFMQEGMLFHSLLDHDSRAYFEQAVFTINGQLDRERFQKSIDAVFER
YDIFRTTFIHKNVAKPRQVVLKNRPSRVQFHDISHLDEKAQDKYADRFRKEDKDKGFDLQ
SDPLMRVSILKKAPERYVCIWSHHHIVMDGWCFGIVMKEFLMIYHSLGDGRLPSLEPVQP
YGKYIKWLMKQDRKEAEIFWKTRLADLEQSASLPKKSAEPNGELEQAVFTISEEQTNELK
NIAARAGATLNTVFQALWGLLLQRVSRCDDAVFGSVVSGRPSDLAGVEKMVGLFINTIPV
RVKSGSSSFLELVRHLQQETLQAEAYSYYPLYDIQAQSPLKQALFDHIIVFENVPAQREI
ENVSQTGSFDFAVEDFTMEEVTNYGCSIKVIPGNSLYIRLNFDTGIYDSVFMKNIETFLR
HMMKSVISDPEICASEIALLDACEARNMLDAFNRTETVEPPAPTLHGLFARRAELSPHRP
ALRFPGGMLTYAELDQYTDRLAVRLRQKGIRKESMVGVLAERSPEMVVSVLAVLKAGGAY
VPLDPEYPEDRLRYMLDDCGACLLLAQPGLSVSGFSGETLEVSLSSLTGETETGAVSEEA
DADSLAYIIYTSGSTGTPKGVAVEHRQAAAFLSGMQGQFPLTEEDIIVLKSSFSFDASIW
QLFWWTMSGASVYLLPAGWEKDPVRMIEAFASEKVTTAHFIPAMVNSFLDALETEPEETR
TRLGRTLTRVFAGGEALSPLTAARFADLLPETMLIHGYGPTEATVDAAFYVCDRKRDSGR
TRLPIGKPVPGARLYVLDSGGTIQPAGVAGELYIAGTGVARGYLNRPELTEERFLDDPFY
PGERMYQTGDIARWTEDGLVEWLGRSDGQVKVRGYRIEPGEIEAAIRRIDGIREAAVTAR
TEHGETALYAYIEGRESDDVRAELATRLPAYMMPAQFIKMTEWPVTPSGKLDRRALPAPG
GAADRQAYTAPRNVTEMKLCALWEEVLKNGPVGIRDHFFERGGHSLKATALVSRIAKEFG
VQVPLQDIFARPTVEELASVIQDLEESPYEAIQPAQKQDTYPVSSAQKRMYVLQQLEDGG
VGYNMPAVLELMGPLDRSRLEETFRQLVERHESLRTSFETGPDGEPMQRIHDSVPFQLDE
AESADAFVRPFCLEEAPLFRAALVKESDEHHLLLTDMHHIISDGVSVNTLIKEFGELYAG
RSLAPMRLQYKDYAVWQRSFQEKEGYQKQEAYWLKRLEGELPVLELPADKPRPAVRSFAG
GSVSCTLDAETASGLHRIARDHGSTLYMVLLAAYNTLLARLSGQEDIIVGSPIAGRPHKD
LEPILGMFVNTLAIRTEPKGDKRFTDYLAEVRQAALEAYEHQDYPFEELVERLGVQRDMS
RNPLFDVMFVLQNMERESLVLNKLHLAQAADTSHKTAKFDATLYASEGSDGSISFDFEFN
TDIYQKQTIEKWLSYFTRILTKVIENQAIPLGDIHVLDNAETNCVIYQFNQTKSDYPRHE
TISRLFERQAKETPDARAVVYDGQILTYRELNERANRIAAALRSNGVGPESVVALLTGRT
TELASGILGILKAGGAYLPIGDDVPRERAEWMLKDCKADILLQSDKLDGLPLTGKRLFIE
DIQTKAGLSSENPEPLGGPESLAYMIYTSGSTGAPKGVMIEQRSVIRLVKNSNYIDFTPE
DRLLFTSSLGFDVTTFEIFGPLLNGASLYVSDQETYLDSDVLGTFIQQNGITTLWLTSSL
FNHLSEQNEHVFSGLSRLIIGGEALSPSHVNRVRNALPHLSVWNGYGPTENTTFSTCFLI
EQSYDHSIPIGRPVGNSTAYIINGRGTPQPIGVIGELCTGGDGVARGYFGRPELTEEKFV
PNPFVPGERMYRTGDLALWLPDGTIEYAGRMDDQVKIRGYRVELGEIEAALRSLDSVKEA
AVSVRTGQSGNKELIAYMSLQADMDTEKVRSSLSKQLPNYMVPAYMMELEKLPLTPNGKL
DRKNLPEPELALQTAYTAPRNELEEQLSVIWQEVLGTKQVGIEDSFFELGGDSIKALQVS
ARLGRYGWKMTASDLFRHPSIKELAPLIRKAERVIDQRPVEGDIPWTPVQHWFLSQRMEN
RNHFNQSVMMFSSDALHKQPLKEALEHLVIHHDALRITVSAENESFRQINHGIQKAELYS
LDIWDLSGTDTWEREIETEVAALQQRMDIEKGPLLKAGWFKTRSGDYLFITVHHLAVDGV
SWRILLEDLSAAYTQAVKGQPVQLPPKTDSFKQYTERLSEYAKSSKLMHEEEYWRFIEEE
TAAELPYEKPQHPTGADSIRQTVSFTLTEEETSVLLQQVNRAYHTDTQDILLTAAALALR
DWTGGGRLRIAMEGHGREHIMPELDISRTVGWFTSMYPVLIDLNTAGAELGTAVKTVKDT
LGRIPDKGIGYGILKYMTPPEQKTIRFRQAPEISFNYLGQFNDTEDQHTFSLSGLASGHD
ITPTWQREQAVEMSAMAVQNKLHFSLSYPPSRFRKETMEQLLQTLQQYLRDIMAHCTGKE
EAEKTVSDFSSKTLTSDDLDSIASFVEEL
NT seq 7650 nt   +upstreamnt  +downstreamnt
atggggcagcaaccggaaatacaagatatatatcctttatcttttatgcaggagggcatg
ctttttcattctctgttggatcatgactcaagagcctacttcgaacaagcggtgtttacg
atcaacggacagcttgaccgggaacgattccaaaaaagtatagatgctgtttttgaacga
tacgatattttccgtacgacatttattcataagaatgtggcgaagccccgccaagtcgtg
ttgaaaaacagaccgagccgcgttcagtttcatgatatttctcatttggacgagaaggca
caagacaaatatgccgaccggttcagaaaagaagataaagataaaggctttgatttgcaa
tcagaccctctcatgagagtctccattttgaaaaaagcgcctgaacgctatgtttgtatc
tggagccatcatcatatcgtcatggacggctggtgcttcgggattgtcatgaaggaattt
ctgatgatctatcattctctcggagacggccggctcccgtctctcgagcctgttcagcca
tatgggaagtatattaaatggctcatgaagcaggatcgtaaagaagccgagattttttgg
aaaacgagacttgccgatcttgagcaatcggcgtctcttccgaaaaaatccgcggaacca
aatggcgaacttgagcaggcggttttcaccatttctgaagagcagacaaatgagctgaag
aacattgcggcaagggcgggagcaacgctgaatacagtgttccaggcactgtggggcctg
ttgctgcagcgtgtcagccgctgtgatgacgccgttttcggttctgtcgtttccggccgg
ccgtcggatctcgcaggcgtggaaaaaatggtaggactgtttatcaatacgattcccgtg
cgggtgaaaagcggttcatcttcttttctggagctcgtcaggcatttgcagcaggagacg
ctgcaagcagaagcgtacagctattatccgctgtatgacattcaggcgcaaagccctttg
aagcaagcgctgtttgaccacattatcgtgtttgaaaatgtgccggcccagcgtgaaatt
gaaaatgtgagtcagaccggttcatttgattttgcggtagaggatttcacgatggaggaa
gtcacaaactacggatgcagcataaaggtgattccgggaaattctctttatatccgctta
aactttgataccggtatatacgacagcgtttttatgaagaatatcgaaacatttttacgg
catatgatgaaatcagtcatctccgatcctgaaatttgcgcctccgagatcgcattgctt
gatgcgtgtgaagccagaaatatgctagatgcgtttaaccgtacagaaacagttgaaccg
ccggctccgacgcttcacggactgtttgcccgccgtgccgagctttcgccgcatcgtccg
gcgctccgttttccgggcggtatgctgacgtacgccgagcttgatcagtacacggacagg
ctcgccgttcggctccgccaaaaaggcatccgcaaagaaagtatggtcggcgtactcgct
gaacgctcgccggagatggtggtttcagtgcttgccgtgttaaaagcgggcggcgcctac
gtgccgcttgacccggagtatcctgaggacaggctgcgctatatgctcgatgactgcggc
gcttgtctcctgcttgcacagccgggattatccgtttccggtttttccggagaaacgcta
gaagtgtctctttcttctctgacaggcgagacggagacaggggctgtctctgaagaagcg
gatgctgattcgctcgcttatatcatttatacgtccggttcgacgggaacaccgaaggga
gtagctgttgaacaccgtcaggccgccgcctttttatcagggatgcaagggcagtttccg
ttaacggaagaggatattatcgtgctgaaatcatccttttctttcgatgcttccatctgg
caattgttttggtggacgatgtcaggcgcctccgtgtatctgcttcctgccggatgggag
aaagatcctgtgcggatgattgaagcgtttgcctcagaaaaggtgacgactgcgcatttt
attccggcaatggtcaacagctttttagacgcgctggaaacggagcctgaggaaacaaga
acacgcctcggcagaacactgacacgcgtgtttgccggaggcgaagctctttccccactt
acggctgcccggtttgccgatctgttgccggagaccatgcttattcacggctatggaccg
acagaagcgacggttgatgcggcgttttacgtctgtgaccgaaaacgggacagcggacgg
acaaggcttccgatcggaaaacccgttccgggtgcccgtctgtatgtattagatagcgga
ggaaccattcagcctgcgggcgtggcaggagagctgtacatcgcggggacaggggtggcc
cgcggctatctgaaccggcccgagctgacggaggagcgttttctcgatgatccgttttat
ccgggagagcgcatgtatcagacgggcgatatcgcacgctggacagaagacggccttgtc
gaatggctcggccgttcagacggacaggtgaaagtccgcggctaccggattgaaccggga
gaaatcgaagcggcgatccggcgcatcgacggcattcgtgaggcggcggtcactgcccgg
accgaacacggcgaaaccgcgctttacgcctatatcgaaggacgggaaagcgatgacgtg
cgggcggagcttgcgacacgccttccggcttacatgatgccggctcagttcataaagatg
accgaatggccggtcacgccgagcggaaagcttgaccgccgcgcgctgccggctcccggc
ggagcggcagacagacaggcgtacaccgccccgcggaacgtcacggaaatgaagctttgc
gctctttgggaagaggtgctgaaaaacggccccgtcggcatccgagatcacttttttgag
cggggcggccattcgttaaaagcgacggctctcgtctcccgcattgccaaagagttcggt
gttcaggtgccgttacaagacatcttcgcccggccgacggtggaagaactcgcttcggtt
attcaggacttggaagagagcccgtatgaagcaattcagcctgcgcaaaaacaggacacc
tacccggtgtcttcggcgcagaaacggatgtatgtgctccaacagcttgaagacggcggt
gtcggctacaatatgccggctgtgctggaactgatgggtccgcttgaccgcagccggctg
gaggagacgttccggcagcttgtggagcggcatgagtcactcagaacgtcctttgaaacg
gggcctgacggcgaaccgatgcagcgcatccatgacagcgtaccgtttcagctggatgag
gccgagtcagctgacgcattcgtccggccgttttgtctggaggaagcgccgctcttccgt
gcggccctcgtaaaagaatcagacgaacaccatcttttattaacggatatgcatcatatt
atttctgacggtgtgtccgtcaacaccttgataaaagaattcggcgagctgtacgcaggc
cgttcgcttgcgccgatgcgccttcaatataaagactatgccgtctggcagcggtcgttt
caggagaaagaagggtaccagaaacaggaagcgtattggctgaagcggctagaaggagag
ctcccggtgcttgagcttccggctgacaagccccgtccggctgtcagaagctttgcgggc
ggcagcgtatcgtgcacgcttgacgctgaaacagcatccggccttcaccgcatcgcccgg
gatcacggctccactttgtatatggtgcttctcgccgcgtacaatacgttactcgcgcga
ttgagcgggcaggaagacatcatcgtcggctcgccgattgccgggcgcccgcacaaagac
cttgaaccgattctcggcatgttcgtcaacacgctcgccatcagaacggagccgaaagga
gacaaacggttcaccgattacttggcggaagtccgccaggcggcgcttgaggcgtatgag
catcaagactatccgtttgaagagcttgtggaacggctcggcgtacagcgggacatgagc
cgcaatccgctgtttgacgttatgtttgtgctccaaaatatggagcgtgaatccctggtg
ttaaataagctgcatttggctcaagctgcggatacaagtcataaaaccgcaaagtttgat
gccacgctttacgcgtcagaagggtctgacggttccatcagctttgattttgaattcaat
acagatatctatcaaaaacagacaattgaaaaatggctttcttattttacccgtattctt
acaaaagtaattgaaaaccaagcgataccgcttggtgacattcacgtactggataatgct
gaaacaaattgcgtcatttatcagtttaatcagacgaaaagcgattacccaagacacgaa
accatcagccgtttatttgagcggcaggcaaaagaaactcccgatgcccgggcagttgta
tatgatggacaaattttgacataccgtgagctgaacgaacgggctaacagaatagcggcg
gctctccgatcaaatggcgtcggtccggaaagcgttgtcgccttattaaccggccgcaca
acagagcttgcctccggaatcctcggaatattaaaagcggggggcgcctacttgcctatc
ggtgacgatgtgccgcgggaacgggctgaatggatgcttaaagactgtaaagctgatatt
cttctccaatctgataaacttgacggtctgccgcttacaggaaaacgtttattcatagag
gatattcaaacaaaggccggattgagttcggagaatcccgagccgctcggcggacctgaa
tcgttggcctacatgatttatacgtccgggtcaacaggtgcgccaaaaggcgtcatgatt
gaacagcgaagcgtgatccgccttgtgaaaaacagcaattatattgattttacgccggaa
gatagactgttgtttacttcatcattaggatttgacgttacgacatttgaaatattcggt
ccgcttttaaacggcgcttctttatatgtaagtgaccaggaaacctatctcgactctgat
gttctgggaacatttatacagcaaaatggcattacgacactgtggctgacatcgtctctg
ttcaaccatttatcagaacaaaatgaacacgtgttttccggattatcccgattgattatc
ggcggggaagcactgtccccgagccatgtaaaccgggttcggaatgcgctgcctcatctc
tcagtatggaatggatacggaccgactgaaaacacgacgttctcgacttgctttttgatt
gaacaatcatacgatcattcaatcccgatcggccgcccagtcggaaattcaaccgcatat
atcataaacggcaggggaacaccacagccgatcggcgtcatcggcgaattatgcactgga
ggagacggtgtggcaagaggatacttcggccgccctgagctgacggaagaaaaatttgtc
cccaatccttttgttcccggagaacggatgtaccgcaccggagatttagccctctggctg
ccggacggaacgatcgaatatgccgggcggatggatgatcaagtgaaaatccgcggttat
cgggtcgagctgggagagattgaagccgcactgaggagcctggacagcgtgaaagaagct
gccgtgtcagtcagaaccgggcagtccggcaataaagaactgatcgcatatatgagtctg
caggcggacatggatacagaaaaagtgcgttcttcactgtctaagcaactgccgaattac
atggttccggcctatatgatggaacttgagaagctgccgcttacgccgaacgggaaattg
gatcggaaaaatctgcccgaaccggagctcgcgcttcaaaccgcgtacacagctccccgc
aatgagcttgaagaacagctttccgtgatctggcaggaagtgctcggcacaaaacaagtc
gggattgaggactcattttttgagctgggcggcgattcaatcaaagcgctgcaagtttcc
gcacggctcggacgctatgggtggaaaatgacggcaagtgacttattccggcacccgtcc
attaaggaactcgcgcctcttatccggaaagcggaaagagtcatcgatcagcggccggtg
gaaggagacataccttggacacccgttcagcactggtttttatcacagcggatggaaaac
agaaatcatttcaatcagtccgtcatgatgttcagctctgacgcattgcataaacagccg
ctcaaagaagccttggagcatcttgtcattcatcatgatgcactccggatcactgtcagt
gcagaaaacgaaagtttcagacaaatcaatcacggtattcaaaaagctgaactgtacagc
ttggacatttgggatctgtctgggacagatacttgggaaagagaaatagaaactgaagtg
gctgcgctccaacagcggatggatattgaaaaagggccgttattaaaagccggctggttc
aaaacccggtcgggggattatttattcatcaccgtacatcacctggcggttgacggagtg
tcatggcgtattctgctggaggatttatctgccgcttacactcaagccgtaaaaggtcag
ccggtccagcttccgccaaagaccgattcgtttaaacaatacactgaacggctttcagaa
tacgcaaaaagcagcaagctgatgcatgaagaagaatattggcgttttattgaagaagaa
acagccgccgaacttccttatgaaaaaccgcagcatccgacgggagccgacagcattcgg
caaacggtaagctttacgcttacagaagaagaaacgtccgttttgcttcagcaggtcaac
cgggcctaccataccgatacgcaagatattcttctgactgccgcagctttggctttacgg
gactggacagggggcggcagattgcgcatcgcgatggaagggcacgggagagagcacatc
atgccggagctcgacatcagccgcaccgtaggctggtttacctccatgtatccggtgctc
attgacttgaacacagcaggcgctgagcttggaacggcggtaaaaacggtcaaagacaca
ctcggaagaataccggataaaggaataggctacggcattttaaaatacatgacaccgcct
gaacaaaaaacaatccgcttcagacaagcgcctgaaatcagctttaactatttagggcaa
ttcaatgatacagaagatcagcacacgttcagtctgtccggtcttgcaagcgggcacgac
atcacgccgacatggcagcgggaacaagcggtggaaatgagcgcgatggccgtacaaaac
aaacttcacttcagtttgagctatccgccgagccgcttccgcaaagaaacgatggaacag
ctgctgcaaaccttacagcaatatttgcgtgatattatggcgcactgcacaggcaaagag
gaagcagaaaaaaccgttagtgattttagcagcaaaacgttaacatctgatgatttggac
agcatagcgagttttgtcgaggaactgtag

DBGET integrated database retrieval system