KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_1203
Entry
BAMF_1203         CDS       T01321                                 
Symbol
med
Name
(GenBank) positive regulator of comK
  KO
K05519  transcriptional activator of comK gene
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
KEGG Orthology (KO) [BR:bao00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bao03000]
    BAMF_1203 (med)
Transcription factors [BR:bao03000]
 Prokaryotic type
  Other transcription factors
   Others
    BAMF_1203 (med)
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: CBI42329
LinkDB
Position
1229342..1230295
AA seq 317 aa
MITRLVMIFSVLLLLSGCAQTPFKGKIEKVGMLFPDTISDLVWGTKGYKGLLAIQSEFNV
DVYYKENIRSDEDILKAIDDLHKKGVNLLYGHGNEYEEIFNMISKDYPDMEFVVANGTAK
NDNVTSVHLMGEAMGFFGGMTAAHMSKTNEVGVIASFLWQPEVDGFIKGAKYENPDITVN
TEFTDHWDNGNEALHLYEKLKAEGTDVVYPAGDGYNVPVIQQIKKDGLYAIGYVAEQSYL
GKNTVLTSTVQNVDKAYTLIAEQYNKGTLKSGDHNFDFREGVVEMGTFSPLVDKAFQDKI
SDLVKTYNQTNELPSNE
NT seq 954 nt   +upstreamnt  +downstreamnt
ttgatcaccaggcttgtcatgatcttttctgtcctccttttattgagcgggtgcgcacaa
actccgtttaaaggaaaaattgagaaggtcggaatgctttttcccgataccatcagtgac
ctggtatggggcacaaaaggttacaaaggtttattagcgatacaatctgaatttaacgtt
gacgtttattataaagaaaatatcagatctgatgaagatattttaaaagcgatagatgat
ttgcataaaaaaggagtcaatcttttatacgggcacggaaatgaatacgaggaaatcttc
aatatgatcagcaaggattatcccgatatggagttcgtcgtcgcaaacggaacggcgaaa
aacgataatgtcacaagcgttcatctcatgggagaagcgatgggctttttcgggggaatg
acggctgcccatatgtcaaaaaccaatgaggtcggcgtcatcgcctcgttcttatggcag
cctgaagtagacggctttatcaaaggggcgaaatacgaaaatcccgatatcaccgtcaat
actgaatttacggaccactgggataacggcaatgaagcgctgcatctttacgagaagtta
aaagcggaaggcacggatgttgtgtatccggccggagacgggtataatgttcctgtcatt
cagcaaatcaaaaaagacgggctttacgccatcggctatgtcgccgagcaatcgtatctc
ggcaaaaacacggtgctgacaagcaccgtgcaaaatgtagacaaagcttatacattaatc
gccgagcaatataataaaggtacgctcaagagcggagatcacaacttcgatttcagggaa
ggagtcgttgaaatggggacgttcagccctttggtggacaaagcctttcaagacaaaatc
tcagaccttgtaaaaacgtataaccaaacaaatgaactgccgtcaaatgaatag

DBGET integrated database retrieval system