KEGG   Bacillus velezensis CAU B946: BACAU_1091
Entry
BACAU_1091        CDS       T01692                                 
Symbol
med
Name
(GenBank) Basic membrane protein A2 Immunodominant antigen P39
  KO
K05519  transcriptional activator of comK gene
Organism
baq  Bacillus velezensis CAU B946
Brite
KEGG Orthology (KO) [BR:baq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:baq03000]
    BACAU_1091 (med)
Transcription factors [BR:baq03000]
 Prokaryotic type
  Other transcription factors
   Others
    BACAU_1091 (med)
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: CCF04625
LinkDB
Position
1151990..1152943
AA seq 317 aa
MITRLVMIFSVLLLLSGCTQTPFKGKIEKVGMLFPDTISDLVWGTKGYKGLLAIQSEFNV
DVYYKENIRSDEDILKAIDDFHKKGVNLLYGHGNEYEEIFNMISKDYPDMEFVVANGTAK
SDNVTSVHLMGEAMGFFGGMTAAHMSKTNEVGVIASFLWQPEVDGFIKGAKYEKPDITVN
TEFTDHWDNGNEALHLYEKLKAEGTDVVYPAGDGYNVPVIQQIKKDGLYAIGYVAEQSNL
GKNTVLTSTVQNVDKAYTLIAEQYNKGTLKSGDHDFDFREGVVEMGTFSPLVDKAFQDKI
SDLVKTYNQTNELPSNE
NT seq 954 nt   +upstreamnt  +downstreamnt
ttgatcaccaggcttgtcatgatcttttctgtcctccttttattgagcggatgcacacaa
actccgtttaaaggaaaaattgagaaggtcggaatgcttttccccgataccatcagtgac
ttggtatggggcacaaaaggttacaaaggtttattagcgatacaatctgaatttaacgtt
gacgtttattataaagaaaatatcagatccgatgaagatattttaaaagcgatagatgat
tttcataaaaaaggagtcaatcttttatacgggcacggaaatgaatacgaggaaatcttc
aatatgatcagcaaggattatcccgacatggaattcgtcgtcgcaaacggaacggcgaaa
agcgataatgtcacaagcgttcaccttatgggagaagcaatgggttttttcgggggaatg
acggccgctcatatgtcaaaaaccaatgaggtcggtgtcatcgcctcctttttgtggcag
cctgaagtagacggctttatcaaaggggcgaaatatgaaaagcctgatatcaccgtcaat
actgaatttacggaccactgggataacggcaatgaagcgctgcatctttacgagaagtta
aaagcggagggcacggatgttgtatatccggccggagacgggtataatgttcctgtcatt
cagcaaatcaaaaaagacgggctttacgccatcggctatgtcgccgagcaatcgaatctc
ggcaaaaacacggtgctgacaagcacggtgcaaaacgtagataaagcctatacattaatt
gccgagcaatataataaaggtacgctcaagagcggagatcacgactttgatttcagggaa
ggagtcgttgaaatggggacgttcagcccgctggtggacaaagcgtttcaagacaaaatc
tcagaccttgtcaaaacgtataatcaaacaaatgaactgccgtcaaatgaatag

DBGET integrated database retrieval system