KEGG   Bacillus velezensis CAU B946: BACAU_1782
Entry
BACAU_1782        CDS       T01692                                 
Symbol
bioI
Name
(GenBank) Cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00780  Biotin metabolism
baq01100  Metabolic pathways
baq01240  Biosynthesis of cofactors
Module
baq_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:baq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BACAU_1782 (bioI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:baq00199]
    BACAU_1782 (bioI)
Enzymes [BR:baq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     BACAU_1782 (bioI)
Cytochrome P450 [BR:baq00199]
 Cytochrome P450, bacteria type
  CYP107 family
   BACAU_1782 (bioI)
SSDB
Motif
Pfam: p450 HU-CCDC81_euk_2
Other DBs
NCBI-ProteinID: CCF05316
LinkDB
Position
complement(1961962..1963158)
AA seq 398 aa
MTAGLSTAHPSLHADSDFWNDPYPFYEKLRAIDPVYKGTVLKHPGWYVTGYKEAAAILKD
TRFKNRVPFPEASTKYQNLSHIQHDMLLFKNQSDHKRMRMLIGKEFTAKTAESLRPCIKE
TVHDLLDQIQNKKNADLVSEFAFPLASLIIAEILGVPKEERYQFRQWTADVIQAIDLTRS
RKMLVRASDTAGRLTAYFRDLIHERKAHPQEDLISRFIMGEQLSKDEVLATCILLVIAGH
ETTVNLMSNGVFTLLKHPEQLSALRENPSLIETAVEECLRYDSPAQLTARTASEDCEING
KTIKKGEQVYILLGAANRDPSIFDQPHKMDIQRKPNPHLAFGKNAHFCIGSSLARIEAQI
AILTLFERMPKLRLAAHRLEYRKLIGFRSLKELPVVLG
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgacggcgggcctatcgactgcacatccgtccctccatgcggattcggatttttggaat
gacccttacccgttttatgaaaaactgcgtgccattgatcctgtttataaaggaaccgta
ttaaaacatccgggctggtatgtcaccgggtataaagaagcggcagcgattttgaaagac
acccggtttaaaaaccgcgtcccttttccggaagcttcaacgaaatatcaaaatctatcg
catatccagcacgatatgctgttatttaaaaatcaatcagaccataagcggatgcggatg
cttataggtaaagaatttaccgcaaagacggcggaatcacttcgcccctgtataaaagaa
acggttcatgacttgttggatcaaatccaaaacaaaaaaaacgcagaccttgtttcagag
tttgcctttccattggcaagcctcatcattgcggagatactcggagtgccgaaagaggag
agatatcaattcagacaatggacggcagacgtcattcaggccattgatcttacccggtca
agaaagatgttagtcagagcaagcgacaccgcaggcaggctgactgcttatttcagagat
ttgattcacgagcggaaagcacatcctcaggaagacttaatcagcaggtttattatgggg
gaacagctttcaaaagacgaagtgctcgcgacatgtatcttacttgtcatagccggacac
gagacgacggtaaacctcatgagcaacggtgtgtttactttattgaaacaccctgaacag
cttagcgcactgagagaaaacccctcgcttattgaaactgctgtcgaggaatgtctgcgc
tacgacagccccgcgcagctgacggcacgcaccgcttcagaagactgtgaaataaatggg
aagaccataaaaaaaggagagcaggtatatatccttttaggggcagccaatcgcgatcca
agcatattcgatcagcctcataaaatggacatccaaagaaaaccgaatccgcatcttgca
ttcggaaagaacgcccatttttgcataggctcctcattagcgcgcatcgaagcacaaatt
gcaattctcacactgtttgagcggatgcctaagcttcggctggccgcacaccgccttgaa
taccgcaagctcattggttttaggtcgctcaaagagcttccggttgtccttggctga

DBGET integrated database retrieval system