Bartonella australis: BAnh1_12360 Help Entry BAnh1_12360       CDS       T02469                                  Symbol tyrA Name (GenBank) chorismate mutase   KO K04092   chorismate mutase [EC:5.4.99.5] Organism baus  Bartonella australis Pathway baus00400   Phenylalanine, tyrosine and tryptophan biosynthesis baus01100   Metabolic pathways baus01110   Biosynthesis of secondary metabolites baus01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:baus00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     BAnh1_12360 (tyrA) Enzymes [BR:baus01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      BAnh1_12360 (tyrA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  AGF75104 UniProt:  M1N5E0 LinkDB All DBs Position complement(1527539..1527814) Genome browser AA seq 91 aa AA seqDB search MQEKILNESARFPASVNNFGAALVHISAGRFRYTQVVGVLKTCRDFPWVDLVREQRQVER WWQSLESHLDLDIAEKFFKIHYRRSYPPSYC NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgcaggaaaaaatactaaatgaatcggcgcgttttccggcatctgttaataatttcggt gcggctttggtccatatctcggcggggcgttttcgttacacgcaagtagtcggggtttta aagacctgtcgtgattttccttgggtggatcttgttcgtgagcaacggcaggttgagcgt tggtggcaatctctagagagccatcttgatctcgatattgctgagaaattttttaaaatt cattatcgaagaagttatccgccatcatattgctaa

DBGET integrated database retrieval system