KEGG   Microvenator marinus: FRD01_13240
Entry
FRD01_13240       CDS       T08125                                 
Name
(GenBank) hypothetical protein
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
bbae  Microvenator marinus
Pathway
bbae00333  Prodigiosin biosynthesis
bbae01100  Metabolic pathways
bbae01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbae00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    FRD01_13240
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: QED28178
UniProt: A0A5B8XTG2
LinkDB
Position
3220496..3223063
AA seq 855 aa
MTTRTPEHRARPRVQAPRRFETFVMPVTAELGEEARRLVGGKAYGLGLAMRAELNVPRAF
VVTTAAFDAMVESVITQVQDIHELRDALLNAPLPTMLQDELEELFSEGQWAVRSSAVEED
GARSFAGQQHSVLGVRGADAIMRGIREVWASLWDPGALAYRARLAVDGMPQSMAVVIQEM
VNPDFAGVLFTQNPVTHQADEAVVSVALGLGTAVVGGEATETFFLERPSGYLKRHETSTP
GEKPLLRGPILEHFARISDRVERLFLKGVDVEWAFNEGEIYVLQLREITTGHDDGAQSVW
SNANVGEALPGVATPLTWSILRDFSARGFKQAFGALGLDVEPEAELVGSFHGRIFLNLSE
FVRIASAIPVLSPDTLLNMAGGGGVEQLSDVARESSKKFIARLPQTLPRIVGTQVAAPLL
APFWEAHFRARCEMFFERDLYRLSQRALESELEDLEKLFDRTGLMMLAVSSNFMLSYVLT
TEYLKWFGVGPEIGNEKLLQGLHVTSAEPGKALLELGRIARRSMRLRRILSGDSAEVYAE
LQKASKHDDVRHFLDELKSFQENFGHRAPREAELATPRWREDVVFVFDVLRGFIDSPHLP
SPREVERESERARDELHALVSRALLPGSLQVFEALLGMMRANAERRESMRARVVDGLDMY
RHFFLECGRRMTQMSIIRRQEDIFFLKIEEIRAWLKDINEGRDFRRRIIVRRAIFESFKS
LPDPPSTFVLKGSQMVWNVNQEALEGRSELAGLAASPGRATGRARVILNPAGATVEPGEI
LVVPYADVGWTPLFVAAAGVVMELGGPLSHASIVAREFRIPAVVNVHSPRVTQVIKTGDL
ITVDGERGIVLLHDE
NT seq 2568 nt   +upstreamnt  +downstreamnt
atgaccacacgtactccggaacatcgcgcgcggccacgtgtgcaagcacctcgtcggttt
gagacgttcgtgatgccggtgacggcagagctgggcgaggaagcgcgacggctcgtgggc
ggaaaggcgtatggactgggcctcgcgatgcgcgccgagctcaacgtgccgcgggcgttt
gtggtcaccacagcggctttcgacgcgatggtggagtcggtgatcacccaggttcaggac
attcacgaactgcgcgatgcgctgctcaatgcgccgctccccaccatgctccaagacgag
ctcgaggagctattctccgagggccagtgggccgtgcgctcgagtgcggtggaagaagac
ggggcgcggagttttgccggccaacaacactcggtcctgggtgtgcgcggcgccgacgcg
atcatgcgagggattcgcgaggtctgggctagcctttgggacccgggagcgctcgcgtac
cgagctcgtcttgcggtagacggcatgccgcaatccatggcggtggtgattcaggagatg
gtcaacccggattttgcgggcgtcctcttcacccaaaacccggtcacgcatcaggccgac
gaagccgtggtttctgtagcgcttggcctcggcaccgcggtggttgggggcgaggcaaca
gagaccttctttttggagcgtccatctgggtatttgaagcgtcatgagacctcgacccca
ggcgagaaacccttgttgcggggcccgatcctcgagcattttgcccgaatctcggatcgc
gtcgaaaggcttttcctcaaaggcgtggacgtggagtgggccttcaacgaaggcgagatc
tacgtcttacaattgcgcgagattacgaccggacacgacgatggagcgcagtctgtctgg
agcaacgcgaatgtcggagaggctctgccgggcgtcgccacaccgctgacctggtcgatc
cttcgggacttcagcgcacggggctttaagcaggcctttggggcgcttgggttagacgtg
gagccggaagcggagctcgtgggcagctttcacggccgaattttcctcaacctaagcgag
tttgttcggatcgcgagcgcgattccagtgctctcgcccgataccttgttaaacatggcg
ggcggcggcggtgtagagcagctcagtgatgtggcgcgcgagagttcaaagaaattcatc
gcgagacttccgcaaaccttacccagaatcgttggaacacaagtggcggcaccgctgctc
gcgccgttttgggaagcgcattttcgagcgcgttgcgagatgttctttgagcgcgacctc
taccgacttagccagcgggcgctcgagagcgagctggaagatcttgaaaaactcttcgac
cgtaccggccttatgatgttggcggtaagctcgaatttcatgctctcttacgtgctcacg
accgaatacctgaaatggtttggtgtgggccccgagattgggaacgagaaactccttcag
gggctgcacgtgaccagtgcggagcctggcaaggctttgctcgaactcggaagaattgct
cggcgctcgatgcgtcttcgtcgcattctttcgggcgattcggccgaggtttatgccgag
cttcagaaagcatcgaagcacgacgatgtccgacatttcttggatgagctgaagagcttc
caggagaattttgggcaccgtgcgccacgcgaggctgagcttgcgacaccacgatggcgc
gaagacgtggtctttgttttcgacgtgctccgcgggtttatcgactcgccccaccttccg
tcaccgcgcgaggttgagcgcgagtcagagcgagcgcgtgacgaacttcatgccctagtt
tcgcgggccctgctgcccggttctctgcaagtttttgaggccttgcttggcatgatgcgt
gccaacgcggagcgccgcgaatccatgcgggcacgcgttgttgatgggctcgatatgtac
cgacacttctttctcgagtgcggtcgccgaatgactcagatgtccatcatcagacgacag
gaggacatctttttcctcaagattgaagagattcgtgcgtggctcaaggatatcaatgaa
gggcgcgatttccggcggcgaatcatcgttcgacgcgcgattttcgagtcgttcaagagt
ctgcctgacccaccttcgacctttgttttgaaaggctcgcagatggtctggaacgtcaat
caggaggcgctcgaaggccgaagcgaactggctggacttgcggcaagccctggacgagcg
actgggcgtgctcgtgtgattttgaaccctgccggtgcgacggttgaacccggagaaatc
ctggtggttccgtacgccgatgtgggctggaccccactctttgtggcggccgccggagtg
gtgatggagctcggcgggccgttgagccacgcctcgattgtcgcgcgtgagttccggatt
ccagcggtcgtaaacgttcattcgccgcgcgtcactcaggtgatcaagaccggcgacttg
atcaccgtggacggagagcgcggaattgtcctcctacatgacgagtga

DBGET integrated database retrieval system