Bombus bifarius (two-form bumblebee): 117214598 Help Entry 117214598         CDS       T07537                                  Name (RefSeq) glutathione S-transferase-like   KO K04097   prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18] Organism bbif  Bombus bifarius (two-form bumblebee) Pathway bbif00480   Glutathione metabolism bbif00590   Arachidonic acid metabolism bbif00980   Metabolism of xenobiotics by cytochrome P450 bbif00982   Drug metabolism - cytochrome P450 bbif01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:bbif00001]  09100 Metabolism   09103 Lipid metabolism    00590 Arachidonic acid metabolism     117214598   09106 Metabolism of other amino acids    00480 Glutathione metabolism     117214598   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     117214598    00982 Drug metabolism - cytochrome P450     117214598 Enzymes [BR:bbif01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      117214598  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.99  Other intramolecular oxidoreductases     5.3.99.2  prostaglandin-D synthase      117214598 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_C_2 Motif Other DBs NCBI-GeneID:  117214598 NCBI-ProteinID:  XP_033316695 UniProt:  A0A6P8NR16 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MRGYSFFHNLFSLRLGGKTQMNVTVGFIYVSEICYYRMVENPEKKEARKNQLLNETIPFY LTKFDQIIGKNKGYIIPSTTTWADFVFTAALENYEYMFGATALDKYPALRALKRRIHSIP AISDWLIRRPFTNS NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagaggctactccttctttcacaacttattttctcttcgtttggggggaaaaacacaa atgaacgtaacggttggtttcatatacgtttcagaaatctgctactatcgcatggtggag aatcctgaaaagaaggaagcgaggaagaatcaacttttgaacgaaacaataccattttac ttgactaaattcgaccagattattggcaaaaataaaggatatatcattccttctaccacg acatgggcggacttcgtatttacagcggcccttgaaaattacgagtatatgtttggggca acagctttagataaatatccagctcttcgagcattgaagagaaggattcatagtataccg gccatttctgattggctgattaggcgcccattcaccaacagttaa

DBGET integrated database retrieval system