KEGG   Bombus bifarius (two-form bumblebee): 117216306
Entry
117216306         CDS       T07537                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
bbif  Bombus bifarius (two-form bumblebee)
Pathway
bbif00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:bbif00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    117216306
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bbif00199]
    117216306
Enzymes [BR:bbif01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     117216306
Cytochrome P450 [BR:bbif00199]
 Cytochrome P450, animal type
  CYP306 family
   117216306
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 117216306
NCBI-ProteinID: XP_033318804
UniProt: A0A6P8NF58
LinkDB
Position
Unknown
AA seq 499 aa
MNFIYAIFVLFVSVLVYVFYINRKVRRLPPGPWQLPIVGYLPWIDAEKPHETLTNLARVY
GPICGLRMGSVYTVLLSDPQLIKQTFSKDMSTGRAPLYLTHGIMKGYGLVCAEGERWKDQ
RKFVSNCLRNFGMIKHEGPKREKMEKRISDAANECATALKNRGANGPIDPLNTLHHCMGN
LVNSIVFGKTYKEEDEVWKWLRHLQEEGVKEIGVAGPLNFLPFLRFLPRYGRTIQSIVDG
KEKTHKVYREILEEHRAQIAQASENTDRVESFLAAFDEQMRKENGTKSEFFTEPQLYHLL
ADLFGAGTDTTLTTFRWFLLFMAAHPTEQEKVQSEMDLCLKEGEQPTLDDRIAMPRLEAA
IAEVQRIRTVTPLGIPHGTSEDMRIGDYDVPRGTMIVPMQWAIHTDPAYWQDPLEFRPDR
FLSDDGSFFKPESFLPFQSGKRICVGEELARMILFLFAGRILRAFVISVPPDEIVDLEGD
CGITLVPKPHRLMFVPRHH
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgaacttcatttacgcgatattcgttttattcgtttccgttcttgtatacgtcttctat
ataaatcgaaaggtacgtcgtctaccacctggtccttggcaacttccgatcgtcggctat
cttccatggatcgatgcagaaaaaccacacgaaactctgacgaatttagccagagtttat
ggtcctatatgtggactccgcatgggttccgtttatactgttttattgtcggatcctcaa
ttaataaagcagaccttctcgaaagatatgtccaccggtagagcacctttgtaccttaca
cacgggattatgaagggatatggtttagtttgcgcggagggagaacggtggaaggatcag
agaaaattcgttagcaattgcttacgaaactttggaatgataaagcacgaaggaccaaag
cgcgagaaaatggagaaacgaatatccgatgcagcaaatgaatgtgcaacggcactgaaa
aatcgcggggcaaatggaccgatcgatccattaaatacgcttcatcattgtatgggtaat
cttgttaatagcatcgtatttggaaaaacctataaggaggaagacgaagtttggaaatgg
ctaagacatttgcaagaagaaggagtgaaagaaattggtgtcgctggaccgctcaacttt
ttaccttttctcagattcttaccacgatacggccgaacgatacaatcgatcgtcgatgga
aaggagaaaacgcataaagtatatcgggaaatactcgaagaacaccgtgcacagatcgcg
caagcatcagaaaatacggatagagtcgagagctttctggcagcattcgacgaacaaatg
aggaaagaaaacggtacaaaatccgagtttttcacagaaccccaactgtaccatttatta
gcagatctttttggtgctggaactgatactactttgaccacctttcgttggtttctctta
ttcatggctgcccatcctacggagcaggaaaaggtacaatcggagatggatctatgtttg
aaggaaggggagcagccgactctagacgatagaatcgctatgcctcgtctcgaggctgct
atagccgaagtgcagaggataaggactgttacaccactcggtattcctcatggaacatca
gaggatatgcggataggtgattacgatgtaccacgcggtaccatgatcgtgccgatgcag
tgggctattcacaccgatcctgcttactggcaagatcctctcgaatttcgacccgacaga
ttcctatccgatgatggaagtttcttcaaaccggaatcgtttctcccatttcaaagtgga
aaacgcatttgcgtgggagaggaactcgctaggatgatactatttttgttcgccgggagg
atactgcgcgcattcgttatatccgtaccaccggacgagatcgtcgatctcgaaggcgat
tgtggcattacgttagttccgaaaccgcatcgcttgatgttcgttccacgacatcattaa

DBGET integrated database retrieval system