Bison bison bison (American bison): 104980467 Help Entry 104980467         CDS       T08726                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism bbis  Bison bison bison (American bison) Pathway bbis04080   Neuroactive ligand-receptor interaction bbis04081   Hormone signaling bbis04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     104980467 (GHRH)    04081 Hormone signaling     104980467 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     104980467 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbis04052]     104980467 (GHRH) Cytokines and neuropeptides [BR:bbis04052]  Neuropeptides   GPCR binding    104980467 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Ret2_MD Motif Other DBs NCBI-GeneID:  104980467 NCBI-ProteinID:  XP_010827492 Ensembl:  ENSBBBG00000014632 UniProt:  A0A6P3GL99 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MLLWVFFLVTLTLSSGSHGSLPSQPLRIPRYADAIFTNSYRKVLGQLSARKLLQDIMNRQ QGERNQEQGAKVRLGRQVDGVWTDQQQMALESTLVSLLQERRNSQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcctcgtgaccctcaccctcagcagcggctcccacggttcc ctgccttcccagcctctcaggattccacggtacgcagatgccatcttcactaacagctac cggaaggttctgggccagctgtctgcccgcaagctactccaggatatcatgaacaggcag cagggagagagaaaccaggagcaaggagcaaaggtacggcttggccgtcaggtggacggc gtgtggacagaccaacagcagatggcactggagagcaccttggtgagcctgctgcaggag cgcaggaattcccaaggatga

DBGET integrated database retrieval system