Bison bison bison (American bison): 104988502 Help Entry 104988502         CDS       T08726                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism bbis  Bison bison bison (American bison) Pathway bbis04060   Cytokine-cytokine receptor interaction bbis04620   Toll-like receptor signaling pathway bbis04622   RIG-I-like receptor signaling pathway bbis04625   C-type lectin receptor signaling pathway bbis04630   JAK-STAT signaling pathway bbis04658   Th1 and Th2 cell differentiation bbis04936   Alcoholic liver disease bbis04940   Type I diabetes mellitus bbis05133   Pertussis bbis05134   Legionellosis bbis05140   Leishmaniasis bbis05142   Chagas disease bbis05143   African trypanosomiasis bbis05144   Malaria bbis05145   Toxoplasmosis bbis05146   Amoebiasis bbis05152   Tuberculosis bbis05162   Measles bbis05164   Influenza A bbis05168   Herpes simplex virus 1 infection bbis05171   Coronavirus disease - COVID-19 bbis05200   Pathways in cancer bbis05321   Inflammatory bowel disease bbis05330   Allograft rejection bbis05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     104988502 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104988502 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104988502 (IL12A)    04622 RIG-I-like receptor signaling pathway     104988502 (IL12A)    04625 C-type lectin receptor signaling pathway     104988502 (IL12A)    04658 Th1 and Th2 cell differentiation     104988502 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     104988502 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     104988502 (IL12A)    05164 Influenza A     104988502 (IL12A)    05162 Measles     104988502 (IL12A)    05168 Herpes simplex virus 1 infection     104988502 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     104988502 (IL12A)    05134 Legionellosis     104988502 (IL12A)    05152 Tuberculosis     104988502 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     104988502 (IL12A)    05144 Malaria     104988502 (IL12A)    05145 Toxoplasmosis     104988502 (IL12A)    05140 Leishmaniasis     104988502 (IL12A)    05142 Chagas disease     104988502 (IL12A)    05143 African trypanosomiasis     104988502 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     104988502 (IL12A)    05330 Allograft rejection     104988502 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     104988502 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     104988502 (IL12A)    04936 Alcoholic liver disease     104988502 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbis04052]     104988502 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:bbis00536]     104988502 (IL12A) Cytokines and neuropeptides [BR:bbis04052]  Cytokines   Interleukins    104988502 (IL12A) Glycosaminoglycan binding proteins [BR:bbis00536]  Heparan sulfate / Heparin   Cytokines    104988502 (IL12A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12 Motif Other DBs NCBI-GeneID:  104988502 NCBI-ProteinID:  XP_010838150 Ensembl:  ENSBBBG00000017024 UniProt:  A0A6P3HHV0 LinkDB All DBs Position Unknown AA seq 221 aa AA seqDB search MCPLRSLLLISTLVLLHHLPHLSLGRSLPPTTASPGRSCLDYSQNLLRAVSNTLQKARQT LEFYSCTSEEIDHEDITKDKTSTVEACLPLELATNESCLASRETSFITNGHCLASGKTSF MTTLCLRSIYEDLKMYHVEFQAMNAKLLMDPKRQIFLDQNMLAAIAELMQALNFDSETVP QKPSLKELDFYKTKVKLCILLHAFRIRAVTIDRMMSYLSSS NT seq 666 nt NT seq  +upstreamnt  +downstreamnt atgtgcccgcttcgcagcctcctcctcatatccaccctggttctcctccaccacctgccc cacctcagtttgggcaggagcctcccccccaccacagcaagcccaggaaggagctgcctc gactactcccaaaacctgctgagggctgtcagcaacacgctacagaaggccagacaaacc ctagaattttactcctgcacttctgaggagatcgatcatgaagatatcaccaaagataaa accagcacagtggaggcctgtttaccactggaattagccacgaatgagagttgcctggct tccagagagacctcttttataactaatgggcattgtctggcttctggaaagacctctttt atgacaaccctgtgccttagaagtatctatgaggacttgaagatgtaccacgtggagttc caggccatgaatgcaaagcttctgatggatcctaagaggcaaatctttctagaccagaac atgctggcagctattgctgagctgatgcaggccctgaatttcgacagtgagactgtgcca cagaaaccctccctgaaagaactggatttttacaagacaaaagtcaagctctgcatcctt cttcacgccttcagaattcgtgcggtgaccatcgacagaatgatgagctatctgagttct tcctag

DBGET integrated database retrieval system