KEGG   Brettanomyces bruxellensis: BRETT_001831
Entry
BRETT_001831      CDS       T07183                                 
Name
(RefSeq) uncharacterized protein
  KO
K12575  kinetochore protein SLK19
Organism
bbrx  Brettanomyces bruxellensis
Pathway
bbrx04111  Cell cycle - yeast
bbrx04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:bbrx00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    BRETT_001831
   04113 Meiosis - yeast
    BRETT_001831
SSDB
Motif
Pfam: Fungal_TACC APG6_N Filament Crescentin
Other DBs
NCBI-GeneID: 64573755
NCBI-ProteinID: XP_041135255
LinkDB
Position
4:complement(651298..653949)
AA seq 883 aa
MSLNASSEEPATSTPSKSTSSKDEVNPDTAISYRTIPHGLTYKHETRHHSSYRRHSTSPK
RTSSTVELKRHPLTCVKDTNYKKLDIVGAKHDLTSILTTVDKNKNKENGKNDKRDQGVGS
DAESDASVHISTGDLTEDGSPRSIFPVPSLANSQGPDDIESSPVNSHQDRVVKKKQSIKM
SRKRNAISVSVSDSKRQHFGDCNADEEGSKLPLIEYHRRNSTSSYRTPVRHDFYSGNSTK
KAPSRTHRSRVIDESKIHQDGDTNPALDPDNSPLANVSQGSIVDQKIEGETEVFDQLKKA
TKSNIHELDAGGAKESDLREADSDTDGQMSDDSDDSNLRMSPVRFNSKALSPLSKESVNV
DSTEQDSVLLALDEKERKLEKERQLEDAASAKDEEVRQSGNVKGAKRPIFTSDQVQEIRN
SFESVVSGLQESLKQKSKRCSLLEKNLSGLKLEVVDAKSKMEQAESEKTQLEATVKTLRV
ESSSATEYAANSDRRCNVADHKLRVCESRLARYKELYVELMGAAKNLEKEVSKEKKTVSQ
LKRKLTEMKQKFERDQAGKSELQSSLELKNAEVKSLLEEKSENEVMIRNLKRINDESDSE
LKKLKARLNATKEKLEDLRKRNDSISTQMADSAKQIKEKAAKLEQMKKERDSALANLTSL
KTRMQNVETSNSKLLLEKKAADSKISKAQRELDELDKKYLEMKKTRNEELQKKLANGQQN
VEKLNEKIKALEEEKSSLEKAVKAEQAAQSKEIQAGIQENKKLNEQNGTLKNRIETLEKE
ITSAKAKIANNDKEMEMQMEKLAQDLYLQYSAKHEQKVATLKKGYEMKWMGKVKKFTRDN
DALKREIASLKKRLEVETNEKKQLVKLWDEYVSLEKKGPKMKS
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgtcgttaaatgcatcttcggaggaaccggcaacgtcaaccccatcaaaatcaacaagt
tcaaaagatgaagtgaatccggacacagcaatatcttaccggactattccccatggtctc
acatacaagcacgaaacacgtcaccattcgtcttataggcgtcattcgacttcaccaaag
cgtacatcgtcgactgttgagctgaaaagacatcctttgacgtgtgtgaaagacacaaac
tacaaaaaactggacatagtgggcgccaagcacgatttgacgtctattctcacaacagtg
gacaaaaacaagaacaaggagaatggcaagaacgacaagagggaccagggggtgggcagc
gacgcggaaagcgacgcgtcagtgcatattagcaccggagatttaactgaagacggatct
ccaaggagtattttccccgttccatctcttgcaaatagccaaggaccggacgatattgaa
tcttcgcctgtgaacagccaccaggaccgtgttgtgaagaaaaagcagagcataaagatg
agccggaaacgaaatgcgatctctgtttctgtttccgacagcaaacggcaacattttggt
gattgcaatgcagacgaagagggatcaaagctccctctgatcgagtatcaccggcgaaac
tcgacatcctcgtaccgcacaccagtccggcatgatttttactccggaaatagcactaaa
aaggccccatcaagaacacatcgaagcagggtgatagatgagtcaaagattcaccaagat
ggggatacaaacccggcattggaccctgataacagtccgcttgccaatgtgagccagggc
agtattgtagaccagaagattgagggtgagacggaggtgtttgaccagcttaaaaaagcg
acaaaatcgaatatccacgagcttgatgcgggcggtgctaaggagtcggatttgcgggaa
gcggactccgacacggacggccaaatgtccgacgacagcgatgatagcaatttgcgaatg
tctccggtccgttttaacagcaaggcactttctccgctttccaaagagagtgtgaatgtt
gattcgaccgagcaagacagtgtgcttttagccttggacgagaaagagaggaagttggag
aaagagagacagcttgaagatgctgccagtgcaaaagatgaggaagtgaggcaatctggc
aatgtaaaaggtgcaaaaaggccgattttcacgtcggaccaagtccaggaaatcagaaac
agttttgaaagtgtggtttccgggctgcaggaatccttgaagcagaaatccaagcggtgc
agtctgcttgagaagaatttgagtgggttgaaactggaagttgttgatgcaaaatcgaaa
atggagcaggcggagtcggagaaaacgcaacttgaggccacagttaagactcttagggtt
gaatcttcgtcggccacggagtatgcagcaaactccgacaggcggtgtaatgtggctgac
cataaactccgggtttgtgagtccagacttgccaggtacaaggagttgtatgtggagctg
atgggagcggcgaaaaaccttgagaaagaggtttcgaaagagaagaagacagtttctcaa
ttgaagcggaagctaacggagatgaaacaaaagtttgagcgagaccaggcgggcaagtcg
gagcttcagtcatcgttagagctcaaaaatgcagaagtgaagagtcttttggaggagaaa
tcggagaatgaggtgatgataagaaatctcaaacgcataaatgacgagagtgactccgag
ctaaaaaagcttaaggcgagactaaatgctacaaaggagaagcttgaagatctcaggaag
agaaatgacagcatatcgacacagatggctgattctgcgaagcagataaaggaaaaagcg
gccaagctggaacaaatgaagaaggagagagactcggcattggcaaatttgaccagtctg
aagaccaggatgcagaatgttgaaacgagcaacagcaaattgctgctagagaagaaggct
gcagacagcaagataagcaaagcccagagagagttggatgagttggataagaagtatctg
gagatgaagaagacccggaacgaggaattgcagaagaaactcgcaaatgggcagcagaat
gttgaaaaactcaacgagaagatcaaggctttggaggaggagaagtccagtctcgaaaag
gcagtcaaagccgagcaggctgctcaatctaaagagatacaggccggaattcaggaaaac
aagaagttgaacgagcaaaacggcacgttgaagaatagaatagagactctggagaaggag
attacgtcagcaaaggccaaaatagcgaataacgacaaagagatggagatgcagatggag
aaactggcgcaggatctatacctccagtattcggcaaagcatgagcagaaggtggcgact
ctgaagaaaggatatgagatgaagtggatgggaaaagtcaaaaaattcaccagagataac
gatgcgttgaagcgtgagattgcaagtcttaaaaagagacttgaggtggagacaaatgaa
aaaaagcagcttgttaagctctgggatgagtatgtgagtcttgaaaagaaggggccgaag
atgaagagctag

DBGET integrated database retrieval system