Bubalus bubalis (water buffalo): 102391874 Help Entry 102391874         CDS       T05912                                  Symbol TBCA Name (RefSeq) tubulin-specific chaperone A   KO K17292   tubulin-specific chaperone A Organism bbub  Bubalus bubalis (water buffalo) Brite KEGG Orthology (KO) [BR:bbub00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bbub04812]     102391874 (TBCA)    04147 Exosome [BR:bbub04147]     102391874 (TBCA) Cytoskeleton proteins [BR:bbub04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Others      102391874 (TBCA) Exosome [BR:bbub04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102391874 (TBCA) SSDB OrthologParalogGFIT Motif Pfam:  TBCA DUF5938 Motif Other DBs NCBI-GeneID:  102391874 NCBI-ProteinID:  XP_045018071 LinkDB All DBs Position 11:93909747..93951829 Genome browser AA seq 108 aa AA seqDB search MADPRVRQIKIKTGVVKRLVKEKMMYEKEAKQQEEKIEKMKAEDGENYAIKKQAEILQES RMMIPDCQRRLEAAHTDLLQLLESEKDLEEAEEYKEARLVLDSVKLEA NT seq 221 nt NT seq  +upstreamnt  +downstreamnt atggccgatcctcgcgtgaggcagatcaagatcaaaaccggcgtggtgaagcggccgaga tcctgcaggagtcccggatgatgattccagactgccagcgcaggttggaagcggcgcaca ctgatcttctgcagttattagagagtgaaaaagacttggaagaagctgaggaatataagg aggcacgtttagtactggattcagtgaagttagaagcctga

DBGET integrated database retrieval system