KEGG   Bubalus bubalis (water buffalo): 102395591
Entry
102395591         CDS       T05912                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X isoform X1
  KO
K06462  integrin alpha X
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04610  Complement and coagulation cascades
bbub04810  Regulation of actin cytoskeleton
bbub05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102395591 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    102395591 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102395591 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:bbub04515]
    102395591 (ITGAX)
   04090 CD molecules [BR:bbub04090]
    102395591 (ITGAX)
Cell adhesion molecules [BR:bbub04515]
 Integrins
  Integrin alpha subunits
   102395591 (ITGAX)
CD molecules [BR:bbub04090]
 Proteins
  102395591 (ITGAX)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 Integrin_alpha FG-GAP_3 VWA_CoxE Transglut_N
Other DBs
NCBI-GeneID: 102395591
NCBI-ProteinID: XP_006070442
LinkDB
Position
24:complement(15161977..15183170)
AA seq 1166 aa
MPTSDLLVMTGTQVFLFLLMAPVSSLCFNLDTEQPTTFRADSPGFGHSVVQYAQWLVVGA
PQEVKAANQTGGLYWCDYGKGRCEAIPLQVPPEAVNMSLGLSMAATTNPFQLLACGPTVH
HACRENMHLTGICFLLASPFRQVKRIPAALQECPRQDQDIVFLIDGSGSIFSSDFNKMLN
FVKAVMSQFQRPSSQFSLVQFSSTHKVHFTFKDFATSSDPLNLLNSVRQLQGWTFTASAI
RFVTDQLFSAAYGARKDASKILIVVTDGEKTENLGYKDVIPRAEAAGIIRYAIGVGSAFR
YKKSLQELIDIASTPSEEHVFQVENFDALRDIQKQLKEKIFAIEGTQTISSSSFELEMSQ
EGFSAVFMPDGPVLGAVGSFSWSGGAFLYPKNKNPTFINMSQEHVDMRDSYLGYSTELAL
WRGAQSLILGAPRHQHTGKVVLFTQVSMQWRPQAEVTGTQIGSYFGASLCSVDVNGDSSS
DLVLIGAPHFYEQTQGGQVSVCSFPRGRAKWQCDAVLRGEPGHPWGRFGAALTVLGDVNG
DRLVDVAIGAPGEQENQGAVYLFHGTSELGISPSHSQRVTGSQLSPSLQYFGQSLSGGQD
LTQDGLADLAVGAQGHALLLRTRPVLRMWANIHITPAEIARSVYECQQLVTFPHDLGKAT
VCLQVSESSKNQLVNLQSIVTFDLTLDPGRLSPRAIFQETGTRNLTRVRELGLKQHCEAV
RLLLPDCVEDSVTPIILRLNFSLVGKPISSLRNLQPMLAVGAQRYFTTSLPFEKNCGADH
VCQDDLSISFGVSDLKTLIVGSNLELNLKVRVWNDGEDSYGTAITFFYPPGLSYRRVTGG
QSHLQSRSLRLTCDSAPAGTQGTRSTRCSVNHLIFREGAQVTFTVTFHVSPMATLGDKLL
LAANVSSENNSPKTSKTAFQLELPVKYAVYTVISSHEQSTKYLNFSASQEEGSGEAQHRY
QVNNLGQRELPVSIDISVPMELNQVAVWKDIEVLNPQNPSIQCSSERTAPTESDFLTHFK
KKPVLDCSIAVCLRFRCDIPSFGVQEEFDFILKGNLSFRWVSQTQQKKVLVVSVAEITFN
RLVYSQLPGQETFLRAQTELVLEKYEVYNPIPLIVGSSLGGLLLLALITALLYKVGFFKR
QYKEMMEGANKQSVPENETGDPQAAQ
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgcccacatctgaccttcttgtcatgaccgggacccaggtttttctcttcctgttgatg
gccccggtgtcctctctctgcttcaacttggacacggagcaaccgacaaccttccgtgca
gacagccctgggtttggacacagtgtggtccagtatgcccaatggctggtggttggagcc
ccccaggaggtaaaggctgccaatcaaacaggcggcctctactggtgcgactacggcaag
gggaggtgtgaggccattcccctgcaggtgcctccagaggctgtgaacatgtccctgggc
ctgtccatggcagccaccaccaacccctttcagctgctggcctgtggccccaccgtgcac
catgcatgccgggagaacatgcacttgaccgggatctgcttcctgctggcctccccgttc
cggcaggtcaagaggatcccggctgccctgcaggagtgcccaaggcaggatcaggacatc
gtctttctgatcgacggctcaggcagcatcttttccagcgattttaacaaaatgttgaac
ttcgtgaaggccgtgatgagccagttccagcgtcccagctcccagttctccctggtgcag
ttttccagcacgcacaaggtgcacttcactttcaaagacttcgctaccagctcagaccca
ctaaacctcctgaattccgtccggcagctgcaagggtggacgttcacggcctcagccatc
cgatttgtcacagatcaactgttcagtgccgcctatggggcccgaaaagatgcctccaaa
atcctcatcgtcgtcactgatggggagaaaacagaaaacctgggttacaaggatgtcatt
ccccgggctgaggccgccggcatcatccgatatgcaattggggtgggatcagcatttcga
tacaaaaagtccttgcaagaattaatcgacattgcctccacaccctctgaagagcatgta
tttcaagtggagaactttgatgctttgcgagacattcagaaacaactgaaagagaagata
tttgccattgagggtacacagaccataagcagtagttccttcgaactggagatgtctcag
gagggcttcagtgctgtgttcatgcctgatggaccagttctgggggctgtggggagcttc
agctggtctggaggtgccttcctgtaccccaaaaataagaaccccaccttcatcaacatg
tcccaggagcacgtggacatgagggactcgtatctgggttactccacagagctggccctt
tggaggggggcacagagcctgatcctgggggccccccgccatcagcacaccgggaaggtg
gtcctcttcacccaggtgtccatgcaatggaggccgcaggctgaagtcacagggacccag
atcggctcctacttcggggcctccctctgttccgtggatgtgaatggagatagtagctct
gacctggtcctcattggggcccctcatttctacgagcagacccaggggggccaggtgtcc
gtgtgctcctttccccgggggagagctaagtggcagtgtgatgctgtcctgcgaggggag
ccgggccacccctggggccgctttggggcagccctgacagtgctgggggatgtgaatggg
gacaggctggtggatgtggccattggggccccgggagagcaggagaaccagggtgctgtc
tacctgttccacggaacctcagaactgggcatcagcccctcccacagccagcgggtcaca
ggctcccagctctcccccagcctccagtatttcgggcagtcgctgagcgggggtcaggac
ctcacccaggatggactggcagacttggctgtgggggcccaggggcatgcactgctgctc
aggaccagacctgtgctcaggatgtgggcaaacattcacatcacacccgcagagatcgct
aggtctgtgtatgagtgtcagcagctggtgacctttccgcatgatctgggcaaggccact
gtctgcctccaagtttccgaaagttccaagaaccagctggttaacctccaaagcattgtg
acctttgacctaacccttgaccccggccgcctgagtcctcgtgccatcttccaagaaacg
gggactcggaatctgacccgtgttcgagagctggggctgaagcagcactgtgaggctgtg
aggttgctccttccggactgtgtggaggactcggtgacccccatcatcttgcgtctcaac
ttctccctggtgggcaagcccatctctagcctaagaaaccttcagcctatgctggcagtg
ggtgcccagagatacttcacaacctctctcccctttgagaagaactgtggcgcggatcac
gtctgccaggatgacctcagcatctcctttggggtctcagacttgaagaccctgatcgtc
gggagtaacctggagctgaacttgaaagtgagagtgtggaatgatggcgaggactcctat
ggaaccgcaatcaccttcttctaccctccagggttgtcttaccgacgtgtgactgggggc
cagagccatctgcagtcgcgttccctgcgcctgacctgcgacagcgcccccgccgggacc
cagggcacccgaagcacccgctgtagcgtcaaccacctcatcttccgtgagggtgcccag
gtcaccttcacggtcacctttcacgtctcccccatggccaccctgggagacaagctgctt
cttgccgccaatgtgagcagtgagaataacagccccaagacaagcaagaccgccttccag
ctggagctccctgtgaagtatgccgtctacaccgtgatcagcagccatgaacaatccacc
aagtacctcaacttctcggcctcacaggaggagggcagcggggaggcccagcacagatac
caggtgaacaacctggggcagagggagctgcctgtcagcatcgatatctcagtgcccatg
gagctgaaccaggtggccgtgtggaaggacatagaggtcctcaacccccagaacccctcc
attcagtgctcttcagagagaacagcgcccacagagtctgatttcctgacccactttaag
aagaagcctgtcctggattgctccatcgctgtctgcctaaggttccgctgtgacatcccc
tccttcggcgtccaggaggaatttgacttcatcctgaagggcaacctcagcttccgctgg
gtcagccagacacagcagaagaaggtgctggtcgtgagcgtggctgaaatcaccttcaac
agacttgtgtattctcagcttccaggacaggagacatttttgagagctcagacggagctg
gtgctggagaagtatgaggtctacaaccccatccccctcattgtgggcagctctctggga
ggactactgctcctggccctcatcacagccctactgtacaaggttggtttcttcaaacgt
cagtacaaggaaatgatggaaggagcaaacaaacagagtgtcccagaaaacgagacagga
gacccccaagctgcccaataa

DBGET integrated database retrieval system