Bufo bufo (common toad): 120982150 Help Entry 120982150         CDS       T07950                                  Symbol CALM1 Name (RefSeq) calmodulin-1 isoform X1   KO K02183   calmodulin Organism bbuf  Bufo bufo (common toad) Pathway bbuf04020   Calcium signaling pathway bbuf04070   Phosphatidylinositol signaling system bbuf04114   Oocyte meiosis bbuf04218   Cellular senescence bbuf04261   Adrenergic signaling in cardiomyocytes bbuf04270   Vascular smooth muscle contraction bbuf04371   Apelin signaling pathway bbuf04625   C-type lectin receptor signaling pathway bbuf04744   Phototransduction bbuf04910   Insulin signaling pathway bbuf04912   GnRH signaling pathway bbuf04916   Melanogenesis Brite KEGG Orthology (KO) [BR:bbuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     120982150 (CALM1)    04020 Calcium signaling pathway     120982150 (CALM1)    04070 Phosphatidylinositol signaling system     120982150 (CALM1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     120982150 (CALM1)    04218 Cellular senescence     120982150 (CALM1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120982150 (CALM1)   09152 Endocrine system    04910 Insulin signaling pathway     120982150 (CALM1)    04912 GnRH signaling pathway     120982150 (CALM1)    04916 Melanogenesis     120982150 (CALM1)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     120982150 (CALM1)    04270 Vascular smooth muscle contraction     120982150 (CALM1)   09157 Sensory system    04744 Phototransduction     120982150 (CALM1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bbuf01009]     120982150 (CALM1)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbuf04131]     120982150 (CALM1)    03036 Chromosome and associated proteins [BR:bbuf03036]     120982150 (CALM1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbuf04147]     120982150 (CALM1) Protein phosphatases and associated proteins [BR:bbuf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      120982150 (CALM1) Membrane trafficking [BR:bbuf04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     120982150 (CALM1) Chromosome and associated proteins [BR:bbuf03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      120982150 (CALM1) Exosome [BR:bbuf04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    120982150 (CALM1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_4 UPF0154 SPARC_Ca_bdg EFhand_Ca_insen EF-hand_11 Dockerin_1 Caleosin Poly_export DUF1103 DnaT_2 TerB PhageMin_Tail Fe_hyd_lg_C DUF6706 PA_Ig-like Motif Other DBs NCBI-GeneID:  120982150 NCBI-ProteinID:  XP_040268054 LinkDB All DBs Position 11:complement(21040550..21047120) Genome browser AA seq 166 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEGKKVAQVVLTSLLQNSLMSCGRPAVV NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcagatcagctgactgaagagcagattgctgagttcaaggaggctttctccttattt gataaagatggggatggcaccattaccactaaggaactgggcaccgtcatgaggtcactc ggccagaaccccacagaagcagagctgcaggacatgatcaacgaagtagatgctgatggc aatggtacaattgactttcctgaatttctgaccatgatggcaaggaaaatgaaggacaca gacagcgaagaagagatccgtgaagcattcagagtgtttgacaaggatggtaacggttac atcagcgcagcagaactccgtcacgtaatgactaacctaggggaaaaacttacagacgaa gaggtagacgaaatgatcagagaagccgatatagatggggatgggcaggtcaattacgaa ggtaagaaagttgcgcaggtggtcctcacttcactgctacagaatagcctgatgagttgt ggcagacctgctgtcgtgtag

DBGET integrated database retrieval system