KEGG Orthology (KO) [BR:bbut00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
142026696 (POLR3G)
09150 Organismal Systems
09151 Immune system
04623 Cytosolic DNA-sensing pathway
142026696 (POLR3G)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:bbut03021]
142026696 (POLR3G)
Transcription machinery [BR:bbut03021]
Eukaryotic type
RNA polymerase III system
RNA polymerase III
Pol III specific subunits
142026696 (POLR3G)
KEGG Orthology (KO) [BR:bbut00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
142029212 (POLR2K)
09124 Replication and repair
03420 Nucleotide excision repair
142029212 (POLR2K)
09150 Organismal Systems
09151 Immune system
04623 Cytosolic DNA-sensing pathway
142029212 (POLR2K)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:bbut03021]
142029212 (POLR2K)
03400 DNA repair and recombination proteins [BR:bbut03400]
142029212 (POLR2K)
Transcription machinery [BR:bbut03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
142029212 (POLR2K)
RNA polymerase III system
RNA polymerase III
142029212 (POLR2K)
RNA polymerase I system
RNA polymerase I
142029212 (POLR2K)
DNA repair and recombination proteins [BR:bbut03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
142029212 (POLR2K)
KEGG Orthology (KO) [BR:bbut00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
142033315 (POLR2H)
09124 Replication and repair
03420 Nucleotide excision repair
142033315 (POLR2H)
09150 Organismal Systems
09151 Immune system
04623 Cytosolic DNA-sensing pathway
142033315 (POLR2H)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:bbut03021]
142033315 (POLR2H)
03400 DNA repair and recombination proteins [BR:bbut03400]
142033315 (POLR2H)
Transcription machinery [BR:bbut03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
142033315 (POLR2H)
RNA polymerase III system
RNA polymerase III
142033315 (POLR2H)
RNA polymerase I system
RNA polymerase I
142033315 (POLR2H)
DNA repair and recombination proteins [BR:bbut03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
142033315 (POLR2H)
150 aa
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF
KEGG Orthology (KO) [BR:bbut00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
142035576 (POLR2E)
09124 Replication and repair
03420 Nucleotide excision repair
142035576 (POLR2E)
09150 Organismal Systems
09151 Immune system
04623 Cytosolic DNA-sensing pathway
142035576 (POLR2E)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:bbut03021]
142035576 (POLR2E)
03400 DNA repair and recombination proteins [BR:bbut03400]
142035576 (POLR2E)
Transcription machinery [BR:bbut03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
142035576 (POLR2E)
RNA polymerase III system
RNA polymerase III
142035576 (POLR2E)
RNA polymerase I system
RNA polymerase I
142035576 (POLR2E)
DNA repair and recombination proteins [BR:bbut03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
142035576 (POLR2E)
KEGG Orthology (KO) [BR:bbut00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
142036310 (POLR3GL)
09150 Organismal Systems
09151 Immune system
04623 Cytosolic DNA-sensing pathway
142036310 (POLR3GL)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:bbut03021]
142036310 (POLR3GL)
Transcription machinery [BR:bbut03021]
Eukaryotic type
RNA polymerase III system
RNA polymerase III
Pol III specific subunits
142036310 (POLR3GL)
KEGG Orthology (KO) [BR:bbut00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
142036960 (POLR3C)
09150 Organismal Systems
09151 Immune system
04623 Cytosolic DNA-sensing pathway
142036960 (POLR3C)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:bbut03021]
142036960 (POLR3C)
Transcription machinery [BR:bbut03021]
Eukaryotic type
RNA polymerase III system
RNA polymerase III
Pol III specific subunits
142036960 (POLR3C)
KEGG Orthology (KO) [BR:bbut00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
142037642 (POLR3D)
09150 Organismal Systems
09151 Immune system
04623 Cytosolic DNA-sensing pathway
142037642 (POLR3D)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:bbut03021]
142037642 (POLR3D)
Transcription machinery [BR:bbut03021]
Eukaryotic type
RNA polymerase III system
RNA polymerase III
Pol III specific subunits
142037642 (POLR3D)
KEGG Orthology (KO) [BR:bbut00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
142037829 (POLR3F)
09150 Organismal Systems
09151 Immune system
04623 Cytosolic DNA-sensing pathway
142037829 (POLR3F)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:bbut03021]
142037829 (POLR3F)
Transcription machinery [BR:bbut03021]
Eukaryotic type
RNA polymerase III system
RNA polymerase III
Pol III specific subunits
142037829 (POLR3F)