KEGG   Bacillus cabrialesii: EFK13_15340
Entry
EFK13_15340       CDS       T08101                                 
Name
(GenBank) cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bcab  Bacillus cabrialesii
Pathway
bcab00780  Biotin metabolism
bcab01100  Metabolic pathways
bcab01240  Biosynthesis of cofactors
Module
bcab_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bcab00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    EFK13_15340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bcab00199]
    EFK13_15340
Enzymes [BR:bcab01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     EFK13_15340
Cytochrome P450 [BR:bcab00199]
 Cytochrome P450, bacteria type
  CYP107 family
   EFK13_15340
SSDB
Motif
Pfam: p450 RhoGAP_pG1_pG2
Other DBs
NCBI-ProteinID: UQE78110
LinkDB
Position
complement(3000433..3001620)
AA seq 395 aa
MTIAFPTASSEFLKNPYPFYETLRAIHSIYKGSFLKYPGWYVTGYEETAAILKDARFKVR
PPLPETSIKYQDLQHVQSQMMLFQNQPDHRRLRTLASGAFTPRMAERYRPYIDETVHHLL
DRVQGEKKMEVISDFAFPLASFVIANMIGVPEEDREQLKDWAASLIQTIDFTRSRKALTE
GNHIAVQAMAYFRKLIQKRKRHPQQDMISMLLKGKEKDKLTEEELASTCLLLAIAGHETT
VNLISNSILCLLQHPEQLLKLKESPDLIGSAIEECLRYESPTQMTARVASEDIDISGVTI
RQGEQVYLLLGAANRDPNRFTNADVFDLTRSPNPHLSFGQGHHICLGSSLARLEAQIAVN
AILQRMTGLKLAGSERRYRPLFGFRALEELPVAFE
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgacaattgcatttccaactgcatcttctgagtttttgaaaaacccatatcctttttac
gaaacattgcgcgctattcattctatatataaagggagtttcttgaaatacccgggctgg
tatgtcacaggatatgaagaaacggcagctattttaaaagatgccagattcaaagtccgg
cccccgctccctgagacgtcaatcaaatatcaggatcttcaacatgtgcaaagtcagatg
atgctgtttcagaatcagcctgatcatagacgattgcggacgctggccagcggagcgttt
actccgagaatggcagagcgttatcgtccgtatatcgatgaaactgtccatcatttgctc
gatcgagtgcaaggtgaaaaaaagatggaggtgatttcggactttgcttttcctttagca
agcttcgtcatagccaacatgataggtgtaccggaggaagatagggagcaattaaaagat
tgggctgcaagcctcattcaaacgattgattttacccggtcaagaaaggcgttaacagag
ggcaatcatattgctgtacaggctatggcatattttaggaagctgattcaaaagcgaaaa
cggcatccgcagcaggatatgatcagtatgcttttgaaggggaaagaaaaggataagctg
acagaagaggaattggcatctacgtgcctattgctggcgattgccgggcatgagacaacg
gtcaatctcatcagcaattcaatcctttgtctgctgcagcatccagaacagcttttgaag
ctgaaagaaagcccggatcttattggctccgccattgaggaatgtttacgctatgaaagc
cccacgcaaatgacagccagagtggcgtcagaagatattgacatcagcggggtgacgatt
cgtcaaggggaacaagtctatcttctgttaggggctgccaatcgagatccaaacagattc
acgaacgccgatgtcttcgatttgaccagaagccctaatccgcatctatcattcgggcaa
ggccatcatatttgcctaggttcctcgctggcacgattagaagcgcaaattgcggtcaat
gccattctgcagcgaatgaccggcctcaaactcgctggttctgaacggcggtaccggccg
ctttttggctttcgggcgcttgaggagctgccggtggcttttgaataa

DBGET integrated database retrieval system