Burkholderia cenocepacia DWS 37E-2: DM40_986 Help Entry DM40_986          CDS       T03488                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bcew  Burkholderia cenocepacia DWS 37E-2 Brite KEGG Orthology (KO) [BR:bcew00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bcew03036]     DM40_986    03400 DNA repair and recombination proteins [BR:bcew03400]     DM40_986 Chromosome and associated proteins [BR:bcew03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     DM40_986 DNA repair and recombination proteins [BR:bcew03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       DM40_986 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N MAGE YL1_C Motif Other DBs NCBI-ProteinID:  AIO41362 LinkDB All DBs Position 1:1080482..1080775 Genome browser AA seq 97 aa AA seqDB search MSSYKDLLAQREKLEKQIEEAKSREYAEVLNDVKQKIADYGFSLAELGLSRAKAGKVGRP RAGVAAKYRDPETGATWSGRGKPPRWIAGKNRDQFAI NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttacaaggacctgctggcccagcgggagaagctggagaagcaaatcgaagaa gcaaagtcgcgcgaatacgcggaagtgctgaatgacgtgaagcagaagattgccgactac ggcttttcgctcgccgaactcggcctcagccgcgcgaaggcaggcaaggtcggtcgcccg cgcgctggcgtggcggcaaaataccgcgatccggaaacgggcgcgacgtggtccggccgt ggcaagccgccgcgctggatcgccggcaagaaccgcgatcagtttgcgatttaa

DBGET integrated database retrieval system