KEGG   Brevibacillus choshinensis: JNE38_26835
Entry
JNE38_26835       CDS       T07271                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
bchs  Brevibacillus choshinensis
Brite
KEGG Orthology (KO) [BR:bchs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bchs03000]
    JNE38_26835
Transcription factors [BR:bchs03000]
 Prokaryotic type
  Other transcription factors
   Others
    JNE38_26835
SSDB
Motif
Pfam: Bmp Peripla_BP_4 Fe-ADH
Other DBs
NCBI-ProteinID: QRG67043
UniProt: A0A890FDX1
LinkDB
Position
5349664..5350671
AA seq 335 aa
MPKLHPFPALFAGLVAGLLLLITSQFLISMTHLNAINERGHSTDKLRVALLLEGPTYDQG
WNSSALESLKELQQRYGFSLEVANNLKPDQVKAAATKYAANDYDLILGHGVIFSEPFTQV
ARSYPNTRFVSFNGEAPYPNQTTIRYDMKPAGFLVGTLAAKMTRSGKVGYILVDKPPEFA
QVKGFQEGVRKASPKAEVIIGKVPDFNDIENAVRTTREMIARGVDVIYTTGDSFNLGVIT
EAQRSKVYTIGYIADQRFIAPDYVLVSMLQDVRQCYRIIMEQFMQNKLPSGKVMYGLGEG
VNRLSPFGPMVPQKIREEIDKELKLLLQHPVSFGG
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgcccaaactgcacccattccccgccctttttgctggtttggtcgctgggttactattg
ctcattacgagtcaatttctcatcagcatgactcatctgaacgctattaacgaacgtgga
cattcaacagacaagctcagggtcgctttgctcctcgaagggcctacatacgatcaaggc
tggaacagcagcgcgcttgagagcttgaaagagctccagcagcgttatggcttctcgctg
gaggtcgccaacaatctcaagcccgatcaagtaaaggcagcggccaccaagtatgcagcc
aacgattacgacctcattctcggtcacggcgtgatcttttccgaaccctttacgcaagtg
gcaaggtcttatccgaatacgcgctttgtctcctttaacggcgaagctccttatcccaat
cagaccacgattcgctacgacatgaagccggcaggttttctggtgggcacgctggcagcg
aaaatgacccgctcgggaaaagtcggctacatcctcgtcgacaagccgcctgaattcgcc
caagtcaaagggtttcaggagggcgtacgaaaggcctcgccaaaggcggaggtcatcatc
gggaaagttccggacttcaacgacatcgagaacgctgttcgcacgacccgagaaatgatt
gcccgtggcgtcgatgtcatttatacgacgggagacagcttcaatctgggggtcatcacg
gaagcgcagcgatccaaggtctacaccatcgggtatatcgcagaccagcgcttcatcgct
ccggattacgtgctcgtctcgatgctgcaggatgtgcgccaatgctaccgcatcatcatg
gagcaattcatgcaaaacaagcttcctagcgggaaagtcatgtacggcttgggagaaggc
gtcaatcggctcagcccctttggccccatggttccccaaaagattcgtgaagaaatcgac
aaggagttgaaactgttgcttcaacaccctgtttcatttggaggatag

DBGET integrated database retrieval system