Burkholderia cenocepacia J2315: BCAM2711 Help Entry BCAM2711          CDS       T00771                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bcj  Burkholderia cenocepacia J2315 Brite KEGG Orthology (KO) [BR:bcj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bcj03036]     BCAM2711    03400 DNA repair and recombination proteins [BR:bcj03400]     BCAM2711 Chromosome and associated proteins [BR:bcj03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BCAM2711 DNA repair and recombination proteins [BR:bcj03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BCAM2711 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  CAR56575 UniProt:  B4EKY0 LinkDB All DBs Position 2:complement(3068656..3068961) Genome browser AA seq 101 aa AA seqDB search MATYRQLSAQLERLQQKIDKEREKAIADAIAEIRAKIDEYDITPEELGFRPAGSGAAAAA TKPKRTLPPKYLNPKTGETWSGRGRAPAWLGKNRGRFLIKD NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcgacctacaggcaactgtccgcacagctcgaacggcttcagcaaaagatcgacaag gaacgtgaaaaggcgattgccgacgcgattgccgaaatccgcgcgaaaatcgacgaatac gacattacgccggaagaactcggttttcgcccggcaggatcgggcgcagccgctgccgcc acgaagcccaagcggaccttgccgccgaagtacctgaacccgaagacgggcgaaacctgg agtggtcgcgggcgggcgccggcatggctcggcaagaatcgcggacgtttcctgatcaag gactga

DBGET integrated database retrieval system