KEGG   Sutcliffiella cohnii: BC6307_04460
Entry
BC6307_04460      CDS       T06787                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
bcoh  Sutcliffiella cohnii
Brite
KEGG Orthology (KO) [BR:bcoh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bcoh03000]
    BC6307_04460
Transcription factors [BR:bcoh03000]
 Prokaryotic type
  Other transcription factors
   Others
    BC6307_04460
SSDB
Motif
Pfam: Bmp Peripla_BP_4 LPAM_2 Methyltransf_2
Other DBs
NCBI-ProteinID: AST90583
UniProt: A0A223KMN1
LinkDB
Position
927757..928713
AA seq 318 aa
MKIRTISFLFFLVLFLAGCGQVEQSEKLHKVGLLVPDTIHDQVWGTKGYKGLLKIQSEFN
VDVFYMEGIEESASIKSAVKEYDEKGINLIFGHGNQYAQVFNEIAKDYPHIHFVCFNAAV
YGENVTSLNFNANAMGFFAGMVASHMTETNNIGVLAAFEWQPEVDGYFEGAYFENPDIKV
HIEFTQNWDDPELAVMLLNEMLENDVDIVYPAGDGYNIPVINTLKEKGLYAIGYVSDQSD
LGENTVLTSTIQHVPELYEIVARRFQDGQLTAGSLFFDFEDEVISLGAFSPLVDEEFQRS
IENHITLYKQTGLLPNQQ
NT seq 957 nt   +upstreamnt  +downstreamnt
atgaaaataagaactatttcattcttattctttcttgtcctttttttagcaggatgtgga
caagttgaacaatcagaaaaattacataaggtaggcttattagttccagataccattcat
gatcaagtatgggggacaaaagggtacaagggattgttaaaaattcaatccgaatttaac
gtagatgtattttatatggaagggatagaggaatcagcttctataaaaagtgcagtaaag
gaatatgatgaaaaaggaattaatcttatattcggtcacggcaatcaatatgcacaagtg
tttaatgaaatagcgaaagattacccacatattcattttgtatgctttaatgcagcagta
tatggtgaaaatgtaacgtccttaaattttaatgctaatgcaatgggcttttttgccggg
atggtagctagtcatatgacagaaacgaataatatcggtgtgcttgctgcgtttgaatgg
cagccagaggtagacgggtatttcgaaggtgcttattttgaaaatccagatataaaagtt
catatcgaattcactcaaaattgggacgacccagaattagcggtaatgttgcttaatgaa
atgttagaaaatgatgttgatattgtttatccagcaggtgatggatataatattcctgta
attaatacgttaaaagaaaaaggcttatacgcaattggatacgtctcagatcaatcagat
ttaggagaaaatacagttttaacgagtactattcaacatgtaccggagctttacgaaata
gttgcacgacgttttcaagatgggcagttaactgccggctctctattttttgattttgag
gacgaagtaatatcactaggtgcatttagcccgttagtggatgaagagttccaacgatct
attgaaaatcatattacattatataaacaaacaggtctactaccaaaccaacaatag

DBGET integrated database retrieval system