KEGG   Bacteroides eggerthii: INE88_04059
Entry
INE88_04059       CDS       T07755                                 
Symbol
kat
Name
(GenBank) 3-aminobutyryl-CoA aminotransferase
  KO
K21585  3-aminobutanoyl-CoA transaminase [EC:2.6.1.111]
Organism
beg  Bacteroides eggerthii
Brite
KEGG Orthology (KO) [BR:beg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    INE88_04059 (kat)
Enzymes [BR:beg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.111  3-aminobutanoyl-CoA transaminase
     INE88_04059 (kat)
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: QUT47211
LinkDB
Position
complement(4700373..4701680)
AA seq 435 aa
MGKGQELYKKAKTLIPGGTSLLSKRPEQLLPENWPAYYSKSKGCRVWDLDGREYIDCGLM
GVGTNTLGYAREEVDGAVMKVVRDGNLTTFNCPEEVYLAERLIKMNPWAGGVRYTRGGGE
ANSMCVRIARAYTGKDKVAICGYHGWHDWYVSVNLGENDALAGHLLPGIPTAGVPKGLRG
SSIPFHYNDFEEIEKIIRNTPDLAAVKMEVCRNFGPAEGYLEHIRNLCNEYGVILIFDEC
TSGFRETFGGLHKKYGVYPDMTIYSKTMGNGYVIAAVLGKKEIMDAAQGSWISSTFWTDR
IGPTAALAALDVMEKERSWEQITAKGLQNKKRWQALADKYGLKINQWGIPALAGYTFDSP
NALAYKTYVTQEMLKKGYLAGTLMYTSLAHTQEILDGYFEALDPVFADIRDFEDGKNVIE
ALEGPVCQAGFKRLN
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgggtaaaggacaagagctttacaaaaaagcaaaaacgctgatccccgggggaacatcg
ttgttatcaaaaagacctgagcagttattgcccgagaattggccggcatattatagcaag
tcaaagggatgtcgtgtatgggatcttgacggtcgtgagtatatcgactgcggtcttatg
ggtgtgggtaccaacacacttggatatgctcgtgaggaggttgatggagctgtgatgaag
gttgttcgtgacggtaaccttaccactttcaattgtcctgaagaagtttatcttgcagaa
cgactcatcaaaatgaatccatgggctggtggtgtacgatacacccgtggtggtggcgaa
gccaactctatgtgcgtacgtattgcacgtgcctatactggtaaggataaggtggcaatc
tgtggctaccatggttggcacgactggtatgtatctgtaaaccttggcgagaacgatgcc
cttgcgggacaccttctccctggtattcctacagcaggcgttcctaagggactccgtggc
tcatctattcctttccactataacgactttgaagagattgagaaaataatccgcaatacg
cctgatcttgcagctgtcaagatggaggtttgccgtaatttcggtcctgctgagggctat
cttgaacatattcgcaatctttgtaacgaatatggtgtaatactcattttcgatgagtgt
acttcaggttttcgagagacatttggtggactccacaagaaatatggtgtttatccagat
atgaccatctattctaagactatgggcaacggatacgttattgctgcagttcttggaaag
aaagaaataatggatgcagctcaaggttcttggattagttctaccttttggaccgatcgt
attggacctaccgcagcgcttgcagcgctcgatgtaatggagaaggaaaggtcttgggag
cagataaccgcaaaggggcttcagaacaagaaacgttggcaggcactagctgacaagtat
ggtttgaagataaaccaatggggtattcctgcacttgccggttacacattcgactctcct
aatgctcttgcatacaagacttatgtgacccaggagatgcttaagaagggttaccttgca
ggaacgctcatgtacacttcacttgctcatacgcaggaaatactcgatggctatttcgag
gctcttgatcctgtttttgcagatattcgcgactttgaggatggcaaaaatgtaatagag
gctcttgaaggccctgtatgtcaagccggttttaagcgacttaactaa

DBGET integrated database retrieval system