KEGG   Priestia filamentosa: BEH_11250
Entry
BEH_11250         CDS       T03983                                 
Name
(GenBank) cytochrome
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
beo  Priestia filamentosa
Pathway
beo00780  Biotin metabolism
beo01100  Metabolic pathways
beo01240  Biosynthesis of cofactors
Module
beo_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:beo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BEH_11250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:beo00199]
    BEH_11250
Enzymes [BR:beo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     BEH_11250
Cytochrome P450 [BR:beo00199]
 Cytochrome P450, bacteria type
  CYP107 family
   BEH_11250
SSDB
Motif
Pfam: p450 PP2C_2
Other DBs
NCBI-ProteinID: AKO95060
UniProt: A0A0H4KND3
LinkDB
Position
2285409..2286635
AA seq 408 aa
MNTTNIESFSFNTSEFFQNPYPFYEEMRSINPIYKSTLLKYQGWYITGYEETLKVLKDSR
FHSRPPIPAFSRNYENIRRIQENMMLFTTPQHHRRLRSLVTKFFTPNIVNECRPFIEETV
DELIDQVSCRGTMEVVSDYAFPLASSVIAKILGVPVKDYSLFKEWTATFIQSIDFTRSPK
TLGNSRKATEEIIAYFKKIIREREQEPKEDLISKLIQEKQREEKLSYDELIATCVLLLIA
GHETTVNLISSSIFLLIQNPRQLEKLQDDPELITTAIEEFLRFESPAQLIARTASEDIII
NEAVIRKGEQVYLFLGAANRDSRKFRNSHQLEITRNPNPHLAFGHSRHFCLGSSLARLEA
KIAIERLLQNVQNLQAVDGNGHYRKIIGFKSLVELHVTFDSYPDENFI
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaatactacaaatatagagtcattttctttcaatacttcagagttttttcaaaatcca
tatccattttatgaagagatgcgatccattaatcctatttataaaagtacattattaaaa
tatcaaggctggtacataacaggatatgaagaaacgttaaaagtcctcaaagattcaaga
ttccatagccgtcctcctatcccggctttttctcgcaactacgagaatattagaagaatc
caagagaatatgatgttatttactactccacaacatcatagacgattacgctctcttgtt
actaaatttttcacaccaaatatcgtaaacgaatgccgtccttttatagaggaaacagta
gatgagctcatagatcaagttagttgtagaggaactatggaagttgtatctgactatgct
ttccctttagcaagttctgttattgctaaaatattaggagtgccagtaaaggattattcc
ttatttaaagaatggacggctacttttattcaatccattgattttacgagatctccgaaa
acgttagggaatagtcgcaaagcaacggaagaaataatagcctatttcaaaaaaataatt
agagagagagaacaagaaccaaaagaagatttgatcagtaaattaattcaggaaaaacag
agagaagagaaattaagttatgatgaactcatagcaacatgtgttttgctcttaattgca
gggcacgaaacgactgttaatcttattagtagttctatctttttattaattcagaaccca
aggcaattagagaaattacaagatgatccagaattaatcacaacagctatagaagaattt
ttgagatttgaaagtcctgcacagcttattgctcgtactgcttcagaagatattattata
aatgaggctgttattcggaaaggagaacaagtctatttatttttaggagctgctaaccgg
gattctagaaagttccggaattctcatcagcttgagattacaagaaatccaaatccccac
cttgcttttggtcacagtaggcatttctgcttggggtcttccttagcacgtctagaagct
aaaattgcgatcgaacgacttttacaaaacgtacaaaatttacaagcggtagatggcaat
ggtcattatcgaaaaattattggcttcaaatctttagtagaattgcacgtaacatttgat
tcatatccagatgagaattttatttaa

DBGET integrated database retrieval system