KEGG   Brevibacillus formosus: BP422_20495
Entry
BP422_20495       CDS       T04939                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
bfm  Brevibacillus formosus
Brite
KEGG Orthology (KO) [BR:bfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bfm03000]
    BP422_20495
Transcription factors [BR:bfm03000]
 Prokaryotic type
  Other transcription factors
   Others
    BP422_20495
SSDB
Motif
Pfam: Bmp Peripla_BP_4
Other DBs
NCBI-ProteinID: ASJ55720
UniProt: A0A220MME1
LinkDB
Position
4436287..4437297
AA seq 336 aa
MPKLLPFPVLFTGLVVGLLLLITSQFVTSMKHLDKVMNKSSHSSDKVRVALLLEGPTYDQ
GWNSSALESMTELQKRYNFSLEIANNIKPEQIKKVAEKYAANDYDLILGHGLIFSDPFTD
VALRYPKSHFVSFNGEAPHPNQTTIRYDMKPAGKLVGILAAKMTKSDKVGYIMVDKPTEL
LQVEGFIEGVKKSSPKTTIIVGKVPDFNDIEGAVRATRDMISQGVDVIYTTGDSFNLEVI
TEAQRAGVFTIGYIADQRYIAPEYVLASMMQDVRQCYRIIMEQFMQGDLPNGKVMYGLAE
GVNQLSQFGHMVPADVREDLERELQNLIPSRGSYGG
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgccgaagctgctgccatttcccgtcttatttaccggtttggtagtcgggctgcttctg
ctcattaccagtcaattcgttacaagcatgaagcatctcgataaagtcatgaataaaagc
agccattcttctgacaaagtgcgtgtcgccctgttactggagggccccacttatgatcaa
ggctggaacagcagtgcactggagagtatgacagaactgcaaaaaagatataacttttca
ctcgaaatcgccaataatataaaaccggagcagatcaaaaaggtggctgagaaatatgca
gccaacgactatgatctcatactcggtcatggcctcatcttctctgatccttttacagac
gtagcgcttcggtatccgaaatcacactttgtttcctttaacggagaggctccgcatccg
aatcaaacgacgattcgttacgatatgaagcctgctggcaagctcgtcggtatcctcgcc
gccaaaatgacgaaatcggataaagtcggatacatcatggtagacaagcccacagagtta
cttcaagtagaaggctttatcgaaggagtgaaaaagtcttcgcccaaaaccactatcata
gtgggaaaggttcctgatttcaatgatattgagggagccgttcgtgcgactcgcgacatg
atttcacaaggtgtggatgtcatctacaccacaggcgacagcttcaatctcgaagtgatt
acagaagcgcagcgagcaggagtatttaccatcggatatattgccgatcaacgctacatc
gctccagaatacgtactggcctccatgatgcaggatgttcgtcagtgctaccgcatcatt
atggaacagtttatgcaaggggatctcccaaatggaaaagtcatgtacggacttgccgaa
ggggtcaaccagctcagtcaattcggacacatggttccagcagatgtacgtgaagattta
gaacgggaactgcaaaatctcattccttcccgtggctcgtatggaggttaa

DBGET integrated database retrieval system