KEGG   Priestia flexa: BC359_19395
Entry
BC359_19395       CDS       T04803                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
bfx  Priestia flexa
Brite
KEGG Orthology (KO) [BR:bfx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bfx03000]
    BC359_19395
Transcription factors [BR:bfx03000]
 Prokaryotic type
  Other transcription factors
   Others
    BC359_19395
SSDB
Motif
Pfam: Bmp Peripla_BP_4 Phage_cap_E ABC_sub_bind ZnuA Endonuc_Holl CoA_binding_2
Other DBs
NCBI-ProteinID: AQX56243
LinkDB
Position
complement(3796189..3797160)
AA seq 323 aa
MEQAKQSKIIIFIAVLFFFILFAVIMLKAQGILHNQGAEPDEKKHVAILTSDVIVDQSWG
SLAYKGKVEIENEFPVIAKVYSQLDSKQKIQNAVQAAVEEKAEVIIGHGREFSPFFNKLA
TSYPDVHFVTIHGTAEHSNQTVYTFDQYQTEYEAGVAASFKTSSNKVGLIDAFEAREKNK
GFENGLMAADQNIEFFYRVVNSRDDSKKAVELMNELVDQGVDVIYTKGNSYNRDIISVAK
EKGIYVIGYLDDQSYMGESQVLTSVINDVPQSYRSIMEDYFSESGLPSGTVVLDENDGVY
RLAPFGPMYTEKEKSTIEDSIEE
NT seq 972 nt   +upstreamnt  +downstreamnt
ttggaacaagcaaaacaatcaaaaataattatctttattgcggtgctgttctttttcatt
ctttttgctgttattatgctaaaagcacaagggattttacataatcaaggggcagaacca
gatgaaaaaaaacatgtcgctattttaactagtgatgttattgtagatcaaagttgggga
agtttagcctataaagggaaagtggaaattgagaatgaattccctgtcattgcaaaggtt
tacagccagcttgatagtaaacaaaaaattcaaaatgctgttcaggctgcagttgaagaa
aaagctgaagtcattattggtcatggaagggagttctctcctttttttaataaattagca
acctcctatccagatgttcacttcgttacgatacacggtaccgctgagcattcaaatcaa
acagtctatacgtttgatcaatatcaaactgaatatgaagcaggagttgcagctagtttt
aaaacaagtagtaacaaagtaggtcttattgatgcatttgaagctcgtgaaaagaataaa
ggctttgaaaatgggctaatggcggcggatcagaatattgaattcttttaccgagtggta
aatagtcgagatgatagtaaaaaagctgttgagttgatgaatgagttagtagaccaagga
gtcgacgtcatttatactaaaggaaattcatacaatcgagacattattagtgtagctaaa
gaaaaaggaatttatgtcataggttatcttgatgatcaatcgtatatgggagagagtcaa
gtactgacaagcgttatcaatgatgtaccacagtcttatcgctccattatggaggactat
tttagcgaaagcggtttaccatcaggaacggtcgttttagatgagaatgatggtgtttat
cgacttgctccttttggtcctatgtacacagaaaaagagaagagcacaatcgaggatagc
atagaagaatag

DBGET integrated database retrieval system