Bufo gargarizans (Asiatic toad): 122921958 Help Entry 122921958         CDS       T07965                                  Name (RefSeq) protein max-like   KO K04453   Max protein Organism bgar  Bufo gargarizans (Asiatic toad) Pathway bgar03083   Polycomb repressive complex bgar04010   MAPK signaling pathway Brite KEGG Orthology (KO) [BR:bgar00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     122921958  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122921958  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bgar03000]     122921958    03036 Chromosome and associated proteins [BR:bgar03036]     122921958 Transcription factors [BR:bgar03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     122921958 Chromosome and associated proteins [BR:bgar03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      122921958 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_2 ANG-1 SlyX DUF7801 PUMA_CC DivIC DUF4763 Motif Other DBs NCBI-GeneID:  122921958 NCBI-ProteinID:  XP_044128241 LinkDB All DBs Position 11:complement(76581122..76589501) Genome browser AA seq 87 aa AA seqDB search MRRKNHTHQQDIDDLKRQNSLLEQQVRALEKAKSNSRLQSNYSSSDSSLYTNPNGSTISA FDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagaaggaaaaatcacacacaccagcaagacatcgatgacctaaagagacaaaactct ctgttagaacaacaagtccgtgcactggagaaagcgaaatccaattctcgccttcagtcg aactactcctcatctgacagcagcctttacaccaatcccaatggcagcaccatatccgcc tttgacggaggatccgactcaagctccgagtccgaacccgaggaaccccaaagcagaaag aagctacggatggaagcgagttaa

DBGET integrated database retrieval system