KEGG   Alkalihalobacillus gibsonii: BGM20_03720
Entry
BGM20_03720       CDS       T04820                                 
Name
(GenBank) non-ribosomal peptide synthetase
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bgi  Alkalihalobacillus gibsonii
Pathway
bgi01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bgi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    BGM20_03720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bgi01008]
    BGM20_03720
Polyketide biosynthesis proteins [BR:bgi01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    BGM20_03720
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C Transferase
Other DBs
NCBI-ProteinID: AOL29787
UniProt: A0A8D4AML8
LinkDB
Position
complement(763530..771194)
AA seq 2554 aa
MPQQPEIQDIYPLSFMQEGMLFHSLYDEQSRAYFEQASFTIHGQLDLERFEKSMDAVFDR
YDIFRTAFIYKNVAKPRQVVLKQRPCPVHVEDISHLNEKDKEHCTEAFKEQDKSKGFDLQ
TDVLMRISILKWAPDHYVCIWSHHHILMDGWCLGIVIKDFLHIYQALGKGQFPDLPPVQP
YGTYIKWLMQQDREEAAEYWKKRLQHFEKASPLPKRTDQMSDGTLQQITFTIPEKETSEL
QKIAAACGATLNTVFQALWGIMLQKFNRRDDAVFGSVISGRPSELKDVENMVGLFINTIP
IRVQSDFLSFSDLVSGMQKDMTEAEAYSYFPLYDIQAQSALKQELIDHIIVFENTPTQQE
IEELNQAGSFDFSVKDFEMEEVTNYRCSVKVIPGRTLYVRIHFHTGAYQPNMMSEIKDYL
LHMISDVISDPSLPVSKMTLLDEDKTRKIVSQNNRTVSVSPEAPTLHGLFERQAAVTPER
PAIRFSGGSLTYAELDMYASRLAAHLAARGVTNKSIVGVLSERSPDMLIAVLAVLKAGGA
YLPLDPAYPKERLSYMLKDSGASLLLTQPGCSAPNFSGETLEVDMTSLEREEVKRHVSAS
VSDGSLAYVIYTSGSTGQPKGVAVEHRQAVSFLTGMQHQFPLSEDDIVMVKTSFSFDASV
WQLFWWTLSGASAYLLPPGWEKDPALIVQAIHQENVTTAHFIPAMLNSFLDQAEMLALGD
GTNLKRVFAGGEPLAPRTAARFASILPQVSLIHGYGPTEATVDAAFYVLDPERDRDRLRI
PIGKPVPGARLYVLDPHLAVQPSGVAGELYIAGAGVARGYLNRPALTEERFLKDPFYPGE
RMYKTGDVARWLPDGNIEFLGRTDDQVKIRGYRIEPGEIEAALRSIEGVREAAVTVRTDS
GEPELCAYVEGLERNEVRAQLERLLPGYMVPAYMIEMEQWPVTPSGKLDRNALPAPGGAA
DAETYTAPRNVTEMKLSQLWEDVLKNGPVGIHDNFFDRGGHSLKATALVSRIAKEFDVQV
PLKDVFAHPTVEGLAAVIREGTDSPYEAIKPAEKQETYPVSSAQKRIYVLQQLEDGGTGY
NMPAVLELEGKLNPERMDRAFKELIKRHESLRTAFEQDEGGDPVQRIHDEVPFTLQTTVL
GERTEQETAAAFIKPFDLSQAPLFRAQIVKVSDERHLLLVDMHHIISDGVSVNILIQEFG
ELYNNRKLPALRIQYKDYAVWQEGFKTGDAYKTQEAYWLKQLEGELPVLDLPADHARPPV
RSFAGDKVSFTLDQEVASGLHKLARENGSTLYMVLLAAYTAFLSRLSGQEDIIVGSPIAG
RPHKDLEPILGMFVNTLALRTRPEGGKPFVQYLQEVRETALEAFEHQDYPFEELVDKLEL
TRDMSRNPLFDVMFVLQNMDQESLELDELCLKPAANNGHQTSKFDLTLYAQEQPHGLLTF
QMEFSTDLYKKKTIEKWLQYFINMLLSIIKDNKAALGTINILNEDETHYLIHELNRTKID
YPRNETISRLFEMQAEQTPNAVAIVSDTQVFTYEDLNSWANQIASVLQIKGVGPDSVVAL
LTGRTPELIAGILGILKAGGAYLPIASDLPVERIAYMLSDSGAALLLQSEKTEKQLLDIE
CEQIIIEDIQKQGKTKNVDSSAGPHSLAYIIYTSGSTGKPKGVMIEQRSVIRLVKNSNYI
TFTPEDRLLMTSSIGFDVGSFEIFGPLLNGAALHLSDQQTFLDSHQLKRYIEHQGITTIW
LTSSLFNHLTEQNEQTFSQLKHLIIGGEALSPSHVNRIRNVCPEVSIWNGYGPTENTTFS
TCLHIQKTYELSIPIGRPVGNSTAYILNQWGVLQPVGAVGELCVGGDGVARGYLGRPDLT
KEKFVPHPFAPGDRLYRTGDLARWLPDGTIEYVGRIDDQVKVRGYRVELGEIESALRQID
GVKEAAVLARTAQTGSKELFGYISVKAGTNAEQVRSLLARSLPNYMIPAYIIEMETLPLT
SNGKLNRKALPEPNFTSQTYAPPRNDLEDQLVLIWQEVLGIQRIGIEDSFFELGGDSIKA
LQVSARLGRYGLSLQVSDLFRHPKIKDLSPFIRKSERIIEQGPVQGDVPWTPVQQWFFSQ
DIEERHHFNQSVMLFHSGHLSENALRPALKKLAEHHDALRMVYRNDDRRWIQINQGIHES
QLYSLRTFDLSQSESGWETQIKQEVADLQQSINLQEGPLLHAALFKTLTGDYLFLAIHHL
VVDGVSWRILLEDLSAGYQQAAAGQTIQLPPKTDSYQEYARRIQEYAQSSKLIREEAYWR
TVEEQQDAELPYEIPHHVNIDFSKRDSLSFSLTEADTAVLLQNINHAYGTDTQDILLTAA
SLAICEWTGGSMLRIAMEGHGREHILPELDISRTVGWFTSMYPALISFENHRYELGTALK
TVKDTLGRIPNKGVGYGMLKYLTHPENKSITFSKTPEISFNYLGQFNDIERQDTFRPSSL
GSGKDITHTWKREQIIEMSAMAADKKLHFNLSYPPARFHRNTMEQLINRIEHFLLDIMKH
CAGQQKTEKTLSDFSSQSLTAEDLDSISSLVEEL
NT seq 7665 nt   +upstreamnt  +downstreamnt
atgccgcagcaacctgaaatacaggatatataccctttgtcatttatgcaggaagggatg
ctttttcactcattgtatgatgaacagtcgagagcttattttgaacaggcttcttttaca
atccatggacagctcgacttggagcgtttcgagaaaagtatggatgctgtttttgacagg
tacgatatctttcgaacagcattcatctataaaaatgtagccaagcctcgtcaagtcgtg
ctcaagcaacgtccttgccctgttcatgttgaagatatttctcatctcaatgaaaaagat
aaagaacattgtacagaggcattcaaagagcaggacaaatccaaaggctttgatctccaa
acggatgtgctgatgagaatatctattttaaaatgggcgcctgatcattatgtctgtatc
tggagccaccatcatattttaatggatggctggtgtttaggcatcgtcattaaagacttt
ctccatatttatcaagcgcttggaaaagggcagtttcctgatttgcctcccgtacagccg
tacgggacgtatattaaatggctgatgcagcaagaccgggaagaagcagctgagtattgg
aaaaagaggcttcagcatttcgaaaaagcttcgcctctgcctaaaagaacagatcaaatg
tcggacgggacattacagcagatcacgtttaccattcctgaaaaagaaacctccgaatta
cagaaaatcgctgcagcatgtggtgcgacacttaacactgtgttccaagctttatgggga
atcatgctccaaaagttcaatcgccgcgacgatgctgtgttcggatcagttatatcaggc
agaccttctgagctaaaagatgtggaaaacatggtcggactttttatcaataccattcct
attcgagtccaaagtgattttctgtctttttctgacctagtcagcggaatgcaaaaggac
atgactgaagcagaagcgtatagttacttccctttatatgacattcaggcgcagagcgct
cttaaacaagagctgattgatcatattatcgtctttgaaaatacacctactcaacaagag
attgaagagctgaatcaagctggatcatttgatttctccgtaaaagattttgagatggaa
gaggtaactaattatagatgcagtgtcaaagtgattccagggcgtactttgtacgttcgg
attcattttcatacaggcgcttatcaaccaaatatgatgtctgagataaaagattattta
ctgcacatgatctctgacgtcatctctgatccatctcttcctgtgtcaaagatgacgttg
ctagatgaggacaaaacacggaaaatcgtttctcaaaataacaggacagtatctgtttca
cctgaagccccaaccctgcatgggctgtttgagcgacaggcggcagtcacaccggagcgg
ccagcgattcgcttttcaggcggttcgctgacatacgctgagcttgatatgtacgccagc
cggctggctgcgcaccttgcggcacgcggcgtcacaaacaaaagtatcgtcggtgtcctg
tctgaacgctcacctgacatgctgatcgctgtccttgctgtattgaaggccggaggggcg
tatttgccgcttgatcctgcgtatccaaaggagcggctgagctacatgctgaaagacagc
ggggcatcgctcttgctgacacagccgggatgctccgcaccgaacttttctggagagacg
cttgaagttgacatgacatctcttgagcgtgaagaagtaaaacgtcatgtgtctgcttct
gttagcgacggatctctcgcctatgtcatctatacatcgggctctaccgggcagccgaaa
ggagtggccgttgagcaccgtcaggctgtttcctttctgaccggcatgcagcaccagttt
ccgctttcggaagatgacattgtcatggtgaaaacctctttttcctttgatgcgtctgtg
tggcagctgttttggtggactctttccggtgcttcggcgtatctgcttccgcccggttgg
gaaaaagaccccgcgttgatcgtacaagccattcatcaggaaaacgtgacaacggctcat
tttattccggctatgctgaacagctttctagatcaagcggaaatgttagcgctcggtgac
gggacaaacctaaagcgtgtattcgccggaggtgaaccgcttgcgccgcgtacggcagcc
cgttttgcttctatcttgccacaggtatcattaatccatggttacgggccgacagaagca
acggtagacgcggcattttacgtgttggacccagaacgggacagggaccgtttgcggatt
ccgattgggaagcccgtacccggtgcgcgtttgtatgttttagatccacatttagccgta
cagccttctggtgtcgccggcgaactgtacattgccggagcgggtgttgccagaggttat
ttgaatcggccggcattaacggaggagcgttttcttaaggacccgttttacccgggtgaa
cgcatgtacaaaaccggggatgtggcgcgctggctccctgacgggaatattgaattcctc
gggcgcacggatgatcaggtgaaaatccgcggctaccggattgaaccgggagaaattgaa
gcggcactaagaagcatagaaggcgtaagggaggcggctgttaccgtacggacagacagc
ggcgagccggaattatgcgcttatgtagaagggctcgaaagaaacgaagtgcgggcacag
cttgaaagactgttgccgggctacatggtcccagcctatatgatagagatggaacagtgg
ccggttacaccaagcggaaagctcgaccgaaacgccctgccagctcctggcggagcggca
gatgcggagacctacacggcgccgagaaacgtgactgagatgaagctttctcagctgtgg
gaggacgtactgaaaaatggccctgtcgggattcacgacaacttttttgaccgcggggga
cattccttaaaagcaacggcgcttgtctcacggatcgccaaagaattcgatgtacaggtg
ccgctaaaagatgtgtttgcccatccgacagtagaaggactggctgccgttatccgtgaa
ggaacggacagtccatatgaagcgattaagcccgctgaaaaacaggaaacctatccggtt
tcctctgcccaaaagcggatttatgtccttcagcagctggaggacggagggacaggctac
aatatgccggctgtgttagagctcgaagggaagctcaaccctgaaaggatggacagagct
ttcaaagagctgatcaagcgccacgagtcgcttcgaaccgccttcgaacaggacgaagga
ggcgatccggtgcagcgcatccatgacgaggtgccgtttacgttacagactacagttctc
ggcgaacgaaccgaacaggagaccgcagccgcatttatcaaaccgtttgatctcagccaa
gcgccgctgttccgtgcccaaatcgtaaaggtatcagatgagcggcacctgttgctggtt
gatatgcatcacatcatttcagacggtgtttccgtcaacattctgattcaagaattcggc
gagctgtacaataatcggaagcttccggcgctgcgcattcaatataaagattatgccgta
tggcaagaaggattcaaaacaggagacgcgtacaaaacgcaggaggcgtactggctgaag
cagctcgagggcgagctgcctgtgctggatcttccggctgatcatgcccgcccgccggtg
cgaagcttcgcgggtgacaaggtctcatttacgctggatcaagaggttgcatcaggcctt
cacaagctggcacgagaaaacggaagcacactgtacatggtgctccttgcggcttacacc
gcgttcttgtcacgcttaagcggacaggaagatatcatcgtcggctcgccaattgccggc
cggccgcacaaggatcttgagccgatactcggcatgtttgtgaacacgctggcgcttcgg
acgcgcccggagggcgggaagccattcgtacagtatttgcaggaagtgcgtgagacagca
ttggaagcctttgagcaccaagattacccgttcgaagagcttgttgataagcttgaattg
acacgagatatgagcagaaatccgctgtttgacgtaatgtttgtccttcaaaatatggat
caggaatcgttggagctggatgaactttgtctcaaacctgcagcaaacaatgggcatcaa
acgtccaaatttgatttaaccctatatgcccaggaacagccccacggtttgctgacgttc
caaatggagtttagtactgacttatataagaaaaaaacgatagaaaagtggcttcaatat
tttatcaatatgttactctccatcatcaaagacaacaaagccgctctcggaacaataaat
atcctgaatgaggatgagacccattaccttatccacgagctcaatcgtacaaaaatagat
tatccaagaaatgaaaccatcagcagactctttgaaatgcaggcagaacaaacacctaat
gctgtagcaattgtcagcgacacccaagtattcacttacgaggacctgaacagctgggca
aatcaaattgcctcagttctacagataaagggcgtagggcctgatagtgttgtagccttg
ttgacaggcagaacaccagaactcattgcaggaatcctgggcattctgaaagccggggga
gcctatctgcctattgcttctgatctgcctgttgaacgaatagcttatatgctgtcagac
agcggggcggcattactccttcaatctgagaaaacagaaaaacagctattagacattgaa
tgtgaacaaatcataatcgaagatattcaaaagcaaggaaaaacgaagaacgttgattct
tcagcagggccacattcactcgcatatatcatttatacctctggatcaaccggtaaacca
aagggtgtcatgattgagcagcgaagtgtaattcgtcttgttaaaaacagcaattatatt
acatttacacctgaagaccgccttctgatgacatcatcaatcggtttcgacgttgggtca
tttgaaattttcggaccgctgctaaatggtgccgctttgcatctgtccgatcaacaaaca
tttctcgattcccatcagcttaagaggtacatagaacatcaaggaatcacaacgatttgg
ctgacatcttctctattcaatcatttgacagaacaaaatgaacaaacattttcacagctg
aaacatttgattattggcggagaagctttgtcgccgagccacgtcaatcgaatcagaaat
gtctgccctgaagtatctatatggaatggatatggccctaccgaaaatacaactttttcg
acatgccttcacattcaaaaaacatatgaactttccattccgattgggcggccggttggt
aattccaccgcttatatcttaaatcaatggggagtgctgcagccggtcggagctgtcggt
gaactttgtgtcggcggagatggcgtcgccagaggatatttgggccgtcctgatttaacg
aaagagaaatttgtcccacatccatttgcacctggcgatcgactgtatcgcacaggtgat
ctggcgcgctggcttcctgacggcacaattgagtacgttggccgtattgatgatcaagta
aaagtcagaggctatcgtgtggagctgggtgagatcgaatcagcacttcgtcaaatagac
ggggtcaaagaagccgcagtgttagcacgtacagcccagaccgggagcaaagagctgttt
ggctatatcagcgtaaaagcaggcacgaatgctgaacaagtgcgttcacttctcgcgcgt
tcgctgccaaactatatgatcccggcgtacattattgaaatggagactcttccgctcaca
tcaaacggcaaattgaaccgaaaagcacttcctgaaccaaatttcacatcacaaacgtac
gctccgcctcgaaatgaccttgaagaccaacttgtgttgatctggcaggaggttctcggc
atccagaggatcggaatagaggattcgttttttgaattgggcggagattcaatcaaagcc
cttcaagtttctgcacgccttggacgctatgggctaagcttgcaggtaagtgatttattc
cgtcatccaaagataaaggacttatcaccatttatccgtaagtcagagagaatcatagag
caaggacccgttcagggagacgttccttggacgcctgttcagcaatggtttttttcacaa
gatattgaagaaagacaccatttcaatcagtctgtcatgctattccattctggacatttg
tctgaaaacgcccttagaccagccttgaaaaaactggcggagcatcatgatgcgcttcgg
atggtttatcgcaacgatgataggcgatggattcaaatcaaccaaggcattcatgagtca
cagctatacagcttaagaacctttgatctttcacagtcagaaagcggctgggagacgcaa
atcaaacaagaagttgcagatcttcagcaaagcatcaatttgcaggaaggaccattgttg
cacgccgctttgtttaaaacactgaccggagattacttgttccttgcgatccatcacctt
gtcgttgatggtgtctcatggcggattttgcttgaggatttgtcagccggatatcaacaa
gctgctgcaggccagacgatccagcttccgcctaaaacggattcctatcaggaatacgca
agacgcatacaggaatatgcccaaagcagtaagctgattcgcgaagaggcgtattggcga
actgtagaagaacagcaagacgcagaactgccctatgaaataccgcatcatgtgaacatc
gacttcagcaaaagggactcattaagcttttcactgactgaagcagacaccgccgtcttg
ctgcaaaacatcaatcacgcctatggcacagatacacaagatattctgttaaccgcagca
tccttggcgatttgtgaatggacaggaggaagtatgctccgtatcgctatggaaggacac
gggagagaacatattctgccagagttagatatcagcaggacggtcggctggtttacatcc
atgtatccggccctcataagctttgaaaatcataggtatgagctcggaaccgcattaaaa
accgttaaagatacactgggccggataccaaacaaaggggtaggttacggtatgctgaaa
taccttacacaccctgaaaataaaagcattacgttttcaaaaacacctgaaatcagcttt
aactatttgggccagttcaacgacatcgaaagacaggacaccttccgcccatcaagcctt
gggagcggaaaggatatcactcatacatggaagcgtgagcaaatcatcgagatgagcgca
atggcagcagacaaaaagctccatttcaatcttagttatccgccagcccgctttcacaga
aacacaatggagcagcttattaacaggattgaacactttttgctggacattatgaaacac
tgcgccggtcaacagaaaacagaaaagacactgagcgatttcagcagtcaatcattaacg
gctgaggacttggacagcatatccagcttggtggaagaattgtag

DBGET integrated database retrieval system