KEGG   Alkalihalobacillus gibsonii: BGM20_20945
Entry
BGM20_20945       CDS       T04820                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
bgi  Alkalihalobacillus gibsonii
Brite
KEGG Orthology (KO) [BR:bgi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bgi03000]
    BGM20_20945
Transcription factors [BR:bgi03000]
 Prokaryotic type
  Other transcription factors
   Others
    BGM20_20945
SSDB
Motif
Pfam: Bmp Peripla_BP_4 LPAM_2
Other DBs
NCBI-ProteinID: AOL32899
UniProt: A0A8E4GXD7
LinkDB
Position
4059353..4060306
AA seq 317 aa
MITRLVMIFSVLLLLSGCGQTPFKGKIEKVGMLFPDTINDLVWGTKGYKGLLNIQSKYNV
DVYYKEGVKTEEDIINAIEDFHKRGVNLLYGHGSEYAEVFNLVGEDYPDMEFVISNAKAK
ADNVTSVHFSGEAMGFFGGMTAAHMSKTNQVGVIASFTWQPEVDGFIKGAKYENPDIEVN
TKYTDHWDDDTTAVKLYQKMKNEGADVVYPAGDGYNVPVIQQIKKDGLYAIGYVTDQSDL
GENTVLTSTVQNVDKAYEIIAEQFNKGTLEGGDHYYDLNTGVVEMGTFSPLVDQDFQQRI
AKLIKTYNKTGELPKNE
NT seq 954 nt   +upstreamnt  +downstreamnt
ttgatcacaaggcttgtcatgatcttttctgtcctccttttattgagtggatgtggacaa
actccgttcaaaggaaaaattgagaaggtcggcatgctctttcctgatacgattaatgac
ctcgtatggggcacaaaagggtataaaggattactgaatatacaatccaaatacaatgtg
gacgtctattataaagaaggcgttaaaacagaagaagatatcataaatgcgattgaggat
tttcataagaggggcgtcaatctgctctacggccatgggagtgaatatgctgaggtgttt
aacttggtcggcgaagattatccagatatggaattcgtcatttccaatgcgaaagcgaaa
gctgataatgtaacaagtgtccattttagcggggaagcaatgggcttttttggaggaatg
actgctgcccatatgtcgaaaacgaatcaggtcggtgtaattgcttcctttacgtggcag
cctgaggttgacggttttatcaaaggggccaagtatgaaaatccggatatagaggtaaat
acgaaatatacggatcattgggatgatgatacaacagcagtaaagctttatcagaaaatg
aagaacgaaggcgcggatgttgtgtatcccgccggagacgggtataatgttcctgttatt
cagcaaatcaaaaaagacggtctttatgccataggctacgtcacagatcaatcggatctg
ggcgagaataccgtattaaccagcacggtgcaaaatgtggacaaggcctatgaaatcatt
gctgaacaatttaataaaggcacccttgagggcggcgatcattactacgacctgaacacg
ggagtcgttgagatgggaacattcagcccgctcgtcgatcaagactttcagcaaagaatc
gccaagctgatcaaaacatacaacaaaacaggcgagctgccaaaaaacgagtaa

DBGET integrated database retrieval system