Burkholderia glumae BGR1: bglu_1g14550 Help Entry bglu_1g14550      CDS       T00905                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism bgl  Burkholderia glumae BGR1 Pathway bgl02024   Quorum sensing bgl03018   RNA degradation Brite KEGG Orthology (KO) [BR:bgl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     bglu_1g14550  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     bglu_1g14550  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bgl03019]     bglu_1g14550    03036 Chromosome and associated proteins [BR:bgl03036]     bglu_1g14550 Messenger RNA biogenesis [BR:bgl03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      bglu_1g14550 Chromosome and associated proteins [BR:bgl03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     bglu_1g14550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ACR28603 LinkDB All DBs Position 1:1601676..1601930 Genome browser AA seq 84 aa AA seqDB search MEYAMSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVY KHAISTVVPARPVNFHPDAEGASS NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggagtacgccatgagcaacaaagggcaattgttacaagacccgtttttgaacgcactg cgtaaggaacacgtgccggtgtcgatctacctcgtcaacggcatcaagctgcaagggaac atcgaatcgttcgaccagtacgtcgtgttgctccggaacacggttacccagatggtctac aagcacgccatctccacggtcgtgccggcccgcccggtgaatttccacccggatgcggaa ggcgcgtcctcctaa

DBGET integrated database retrieval system