KEGG   Bifidobacterium pullorum subsp. gallinarum: ESN35_08715
Entry
ESN35_08715       CDS       T06507                                 

Name
(GenBank) aminoglycoside phosphotransferase family protein
  KO
K13059  N-acetylhexosamine 1-kinase [EC:2.7.1.162]
Organism
bgx  Bifidobacterium pullorum subsp. gallinarum
Brite
KEGG Orthology (KO) [BR:bgx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ESN35_08715
Enzymes [BR:bgx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.162  N-acetylhexosamine 1-kinase
     ESN35_08715
SSDB
Motif
Pfam: APH Pkinase Choline_kinase
Other DBs
NCBI-ProteinID: QAY33476
UniProt: A0A4P6DUR0
LinkDB
Position
CACC514:complement(2000626..2001702)
AA seq 358 aa
MTGNEAKYAAAANFAVDGEIRSVERYGDGHINATYLVTTDTGRYIMQRMNTEVFPDTANL
MRNIELVTEFLRSRGQETLEIIRTKDGATYVETADGAYRMYAFIEDTISYNLVPDADTFR
GAGAAFGEFQNQLADFDASQLTETIAHFHDTPHRFEAFKAAVAADAKGRAAGCRDEIAFY
MDHADRYGTIVDGLHDGTVPLRVTHNDTKLNNILMDAETHAARAIIDLDTVMPGSMLYDF
GDSIRFGASTALEDERDLDKVHFSPELFRAYTEGFLGKVLPSITARELELLPYAGTMMTL
ECGMRFLADYLAGDTYFAIRYPEHNLVRARTQIKLVQEMEEQADDIAAIVADVVERLS
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgacgggcaatgaagccaaatacgccgcggcggccaatttcgccgtcgatggcgagatc
cggtcggtcgaacgctacggcgacggtcatatcaacgccacctacctggtcaccaccgat
accgggcgctacatcatgcagcgcatgaacaccgaggtgttccccgacacggcgaacctg
atgcgcaacatcgaactggtcacggagttcctgcgctcacgcggacaggagaccctcgag
atcatccgcaccaaggacggcgccacatacgtcgagaccgcggacggcgcctaccgcatg
tacgcgttcatcgaggacacgatctcctacaacctcgtgcccgacgccgacacgttccgc
ggcgccggcgccgcattcggcgaattccagaaccagctcgccgatttcgacgcctcccag
ctcaccgagacgatcgcgcacttccatgacaccccgcaccggttcgaggcgttcaaagcc
gcggtcgcggcggacgccaagggccgcgccgccggctgccgcgacgagatcgccttctac
atggaccacgccgaccggtacggaaccatcgtggacgggctgcacgacggcacggtcccg
ctgcgcgtcacgcacaacgacaccaaactcaacaacatcctgatggacgccgaaacccat
gcggcacgggcgatcatcgacctggacacggtcatgccggggtcgatgctctacgacttc
ggcgactccatccgcttcggcgcctccacggcgctcgaagacgaacgcgacctggacaag
gtgcatttcagccccgaactgttccgcgcctacaccgagggattcctcggcaaggtgctg
ccgagcatcacggcccgcgaactcgaactgctgccctacgccggcaccatgatgacgctg
gaatgcggcatgcggttcctggccgactaccttgccggcgacacctacttcgccatcagg
taccccgaacataacctggtgcgcgcccgcacgcagatcaagctcgtgcaggagatggag
gaacaggccgacgacatcgcggccatcgtcgcggatgtcgtggaaaggctgtcgtaa

DBGET integrated database retrieval system