KEGG   Halalkalibacterium halodurans: BH2889
Entry
BH2889            CDS       T00039                                 
Symbol
med
Name
(GenBank) transcriptional activator of comK gene
  KO
K05519  transcriptional activator of comK gene
Organism
bha  Halalkalibacterium halodurans
Brite
KEGG Orthology (KO) [BR:bha00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bha03000]
    BH2889 (med)
Transcription factors [BR:bha03000]
 Prokaryotic type
  Other transcription factors
   Others
    BH2889 (med)
SSDB
Motif
Pfam: Bmp Peripla_BP_4
Other DBs
NCBI-ProteinID: BAB06608
UniProt: Q9K8W3
Structure
LinkDB
Position
complement(3004078..3004950)
AA seq 290 aa
MVGLLVEDTIDDQGWNRKAYEGLLNIHSNLDVDVVLEEGVNSEQKAHRRIKELVDGGVNL
IFGHGHAFAEYFSTIHNQYPDVHFVSFNGEVKGENITSLHFEGYAMGYFGGMVAASMSET
HKVGVIAAFPWQPEVEGFVDGAKYMNESEAFVRYVGEWTDADKALELFQELQKEQVDVFY
PAGDGYHVPVVEAIKDQGDFAIGYVGDQADLGGSTILTSTVQHVDDLYVLVAKRFQEGKL
ESGNLYYDFQDGVVSLGEFSSVVPDEVREQITDAISTYIQTGQFPHEEER
NT seq 873 nt   +upstreamnt  +downstreamnt
atggtaggattgttagtcgaagataccatcgatgaccaaggctggaatcgaaaggcttat
gaaggattgctaaatattcatagcaacttagatgtagatgttgtcttagaagaaggtgtg
aacagtgagcaaaaagcccaccgacgaataaaagaattagttgatggtggggtaaatctt
atttttggacacggacatgccttcgccgaatatttctcgaccatacataatcaataccca
gatgtgcactttgtaagctttaatggagaagtgaagggtgaaaatataacaagccttcat
tttgaagggtacgcgatgggctactttggtggtatggtggcagcaagcatgagtgagact
cataaggtcggcgtcattgcagcattcccatggcagcctgaagtagaaggatttgtcgat
ggtgctaagtacatgaatgaatcggaagcctttgttcggtacgtaggagaatggacagat
gctgacaaggcactagagttatttcaggaattgcaaaaagagcaggttgatgttttttat
cctgcaggggatggctaccatgtcccagtcgttgaagcgattaaagatcaaggagatttt
gctattgggtatgtcggggatcaagccgatttaggagggtctacaattttaacgagcacc
gtccagcatgtcgatgatttatatgtactcgtagcgaaacggttccaagaagggaaacta
gaatcagggaacttatattatgactttcaagatggagtcgtatctcttggggagtttagc
tcggttgttccagatgaagtaagagagcaaataacagatgccatctcgacctatattcaa
acgggtcaatttccacatgaggaagaacgttag

DBGET integrated database retrieval system