KEGG   Burkholderia humptydooensis: I6G56_26270
Entry
I6G56_26270       CDS       T08266                                 
Name
(GenBank) AMP-binding protein
  KO
K20423  2-hydroxy-7-methoxy-5-methyl-1-naphthoate---CoA ligase [EC:6.2.1.43]
Organism
bhg  Burkholderia humptydooensis
Pathway
bhg01100  Metabolic pathways
bhg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bhg00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01059 Biosynthesis of enediyne antibiotics
    I6G56_26270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bhg01008]
    I6G56_26270
Enzymes [BR:bhg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.43  2-hydroxy-7-methoxy-5-methyl-1-naphthoate---CoA ligase
     I6G56_26270
Polyketide biosynthesis proteins [BR:bhg01008]
 Polyketide tailoring proteins
  Others
   I6G56_26270
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: QPS47867
UniProt: A0A7T2U8Z3
LinkDB
Position
2:1431736..1433358
AA seq 540 aa
MNGHPALLNQRLAAALQTGEDAPALVAAGTVISYRQLMVQVAATAARLRTAETGKGDRVA
FQLPNCADAVVLMLAALMTGAVPVPMLPAYRERELRHVLKATRPRVIALTKGNRRFSAAR
VVTDFLRDENLDVALRLLDGSPGDEHAGWRDLGLFCSAPSDATAFSECAAAEMLAEDTAM
MLLSSGTTGLPKAIARLNGGYSYMIAKACRVFELSRQSVYLAAMPISHGFVINCPGMLGT
LICGGTVVLASDTSVQTALELVSAHGVTHTTLVPALLTQWLEQSDDLPARPGTLQHVQVG
GSRLSPDLAARAESKLGIRIQQCYGMSEGLLCFTRSTDTDAVRFHSQGRPLSEQDQVLIV
DESGTPVPCGASGELITRGPYTIKTYYNDPLASSRAFTPDGYYRTGDLAHLDADGNVYID
GRVTDSINRGGEKFSPEELEELSKGHARLKDAACVGMADPRFGEVACLFAVAHEGEPLLL
SDIRQYLETAGVASFKLPEKLVLVDEIPRKGIGKIDRALLRARVRDDAEGAGQASKAALL
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgaacggccaccctgccctcctgaaccagcggctggcggccgccctgcaaaccggcgaa
gacgctcccgcactggttgccgccggcactgtgatctcataccggcagttgatggtgcag
gtcgccgctaccgcggcacggcttcgcactgcagagaccggcaaaggcgaccgcgtcgcg
ttccagttgcccaattgcgccgatgccgtcgtgttgatgcttgcggcactgatgacggga
gccgtccccgttcccatgctccccgcataccgggaacgggaacttcgacacgtactcaag
gcgacgcgtccccgcgtcattgcgctgaccaaaggcaatcggcgcttcagcgcggcgcgc
gtcgtgaccgactttctccgcgacgagaaccttgatgtcgcgcttcggctgctcgacggt
tcgccgggcgatgaacatgcgggctggcgcgaccttggcctcttctgctccgcgccctcc
gacgcgaccgcgttcagcgaatgcgccgctgccgaaatgcttgccgaggatacggcgatg
atgctgctatccagcggcacgacgggcttgccgaaagccatcgcgagactgaacggcggc
tacagctacatgatcgcgaaagcctgtcgggtatttgagctcagccgccagtccgtctac
ctcgcggccatgccgatctcgcacggctttgtcatcaactgtcccggcatgctcggcacc
ctgatctgcggcggaaccgtcgtcctggcatccgatacgtcggttcaaacggccctggag
ctcgtcagcgcacacggggtaactcacaccacgctcgttccggcattgctgacgcaatgg
ctcgagcaaagcgatgacctgcccgccagacccggcacattgcaacacgtccaggtgggc
gggtcgcgcctgtccccggacctcgccgctcgcgccgaatcgaaattgggcatccgcatt
cagcagtgctacggaatgagcgaggggctgctttgcttcacccgcagtaccgacaccgat
gcagtccgcttccattcacaggggcgtccgctgtccgagcaggaccaggtgctgatcgtc
gatgaaagcggtacgccagtgccctgcggcgcatccggcgaactgatcacccgcggtccg
tacacgatcaagacctattacaacgacccgctagcctcttcccgcgcctttacaccggac
gggtactaccgcaccggcgacctagcccatctcgatgccgatggcaacgtctatatcgac
gggcgcgtgaccgactccatcaaccgcggcggcgagaaattcagccccgaggaactcgaa
gaattgagcaaggggcacgcccggctcaaggacgccgcctgtgtcggcatggccgacccg
cgcttcggcgaagtggcctgcctgttcgccgtcgcgcatgaaggcgaaccgttgttgctg
tcggatatccgccagtatttggagacggctggcgtcgcgtcgttcaagctgccggagaaa
ctcgttctggtcgacgagataccccgcaagggcattgggaagatcgatcgcgcattgctc
cgggcaagggttcgcgacgatgccgaaggtgccggacaggcatcaaaggcggcactgcta
tga

DBGET integrated database retrieval system