Bradyrhizobium icense: LMTR13_22680 Help Entry LMTR13_22680      CDS       T04485                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bic  Bradyrhizobium icense Pathway bic00998   Biosynthesis of various antibiotics bic01100   Metabolic pathways bic01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bic00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LMTR13_22680   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LMTR13_22680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ANW02552 UniProt:  A0A1B1UIH3 LinkDB All DBs Position complement(4783535..4783774) Genome browser AA seq 79 aa AA seqDB search MSEIGERVKKIVVEHLGVEPDKVVDNASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgagattggcgagcgggttaagaagattgtggtcgaacacctcggtgttgaaccc gataaggttgtcgacaacgcaagtttcatcgacgacctcggcgccgacagcctcgacacc gtcgagcttgtgatggcatttgaagaagagttcggctgcgagattcccgatgacgctgcc gagacgattttgaccgtcggcgatgcgacgaagtttctcgagaagaacgcgaaaagctga

DBGET integrated database retrieval system