KEGG   Bacillus inaquosorum: AN935_15110
Entry
AN935_15110       CDS       T07179                                 
Name
(GenBank) cytochrome
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
biq  Bacillus inaquosorum
Pathway
biq00780  Biotin metabolism
biq01100  Metabolic pathways
biq01240  Biosynthesis of cofactors
Module
biq_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:biq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AN935_15110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:biq00199]
    AN935_15110
Enzymes [BR:biq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     AN935_15110
Cytochrome P450 [BR:biq00199]
 Cytochrome P450, bacteria type
  CYP107 family
   AN935_15110
SSDB
Motif
Pfam: p450 Cas_Cas5d RhoGAP_pG1_pG2
Other DBs
NCBI-ProteinID: AMA53536
LinkDB
Position
complement(2968211..2969398)
AA seq 395 aa
MTIAFPTASSEFLKNPYPFYETLRAIHPIYKGSFLKYPGWYVTGYEETAAILKDARFKVR
TPLPEASTKYQDLQHVQSQMMLFQNQPDHRRLRTLASGAFTPRMAESYRPYIDETVHHLL
DQVQGKKKMEVISDFAFPLASFVIANIIGVPEEDREQLKEWAASLVQTIDFTRSRKALTE
GNHIAVQATAYFRELIQKRKRHPQQDMISMLLKGKEKDKLTEEEAASTCILLAIAGHETT
VNLISNSILCLLQHPQQLLKLKENPDLIGTAVEECLRYESPTQMTARVASEDIDMSGVTI
RQGEQVYLLLGAANRDPNIFAHADVFDMTRSPNPHLSFGHGHHVCLGSSLARLEAQIAIH
TLLQRMPGLKLADSEWRYRPLFGFRALEELPVAFE
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgacaattgcatttccaactgcatcttctgagtttttgaaaaacccatatcctttttac
gaaacattgcgcgctattcatcctatatataaagggagtttcttgaaatacccgggctgg
tatgtcacaggatatgaagaaacggcagctattttgaaagatgccagattcaaagtccgg
accccgctccctgaggcgtcaaccaaatatcaggaccttcaacatgtgcaaagtcagatg
atgctgtttcagaatcagcctgatcatagacgattgcggacgctggccagcggagcgttt
actccgagaatggcagagagttatcgtccgtatatcgatgaaactgtccatcatttgctc
gatcaagtgcaaggtaaaaaaaagatggaggtgatctcggactttgcttttcctttagca
agcttcgtcatagctaacattataggtgtaccggaggaggatagggagcagttaaaagaa
tgggctgcgagtctcgttcaaacgattgattttacccggtcaagaaaggcattaacagag
ggtaatcatatcgctgtacaggccacggcttattttagagagctgattcaaaagcgaaaa
cggcatccgcaacaggatatgatcagcatgctcttgaaggggaaagaaaaggataagctg
acggaagaggaagcggcatctacatgcatattactggcgatcgccggacatgagacaacc
gtcaatctcatcagcaattcaattctttgcctgctgcagcacccacaacagcttttgaag
ctaaaagaaaacccagatcttattggtaccgcagttgaggaatgtttacgctatgaaagc
cccacgcaaatgactgccagagttgcatcagaagatattgacatgagcggagtgacgatc
cgtcaaggagaacaagtctatcttctgttaggggctgccaatcgagatccaaacatattc
gcgcacgccgatgtcttcgatatgacccgaagccctaatccacacctttcattcgggcat
ggccatcatgtttgcctaggatcctcgctggcacgattagaagcacaaattgcgattcat
acccttctgcagcgaatgcccggccttaaacttgctgattctgaatggcgataccggccg
ctttttggctttcgggcgcttgaagagctgccggtggcttttgaataa

DBGET integrated database retrieval system