KEGG   Bacillus intestinalis: BIS30_04465
Entry
BIS30_04465       CDS       T05513                                 
Name
(GenBank) cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bit  Bacillus intestinalis
Pathway
bit00780  Biotin metabolism
bit01100  Metabolic pathways
bit01240  Biosynthesis of cofactors
Module
bit_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bit00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BIS30_04465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bit00199]
    BIS30_04465
Enzymes [BR:bit01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     BIS30_04465
Cytochrome P450 [BR:bit00199]
 Cytochrome P450, bacteria type
  CYP107 family
   BIS30_04465
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AJW84488
LinkDB
Position
complement(819193..820380)
AA seq 395 aa
MTIASSTASSEFLKNPYPFYETLRAVHPIYKGSFLKYPGWYVTGYEETAAILKDARFKVR
TPLPETSIKYQDLTHVQNQMMLFQNQPDHRRLRMPASGAFTPRMAERYRPYIDETVHHLL
DQVQGEKKMEVISDFAFPLASYVIANIIGVPAEDREQLKDWAASLIQTIDFTRSRKALIE
GNHSAVQAMAYFRELIQKRKRHPQQDMISMLLKGKEKDKMTEEEVASTCILLAIAGHETT
VNLISNSILCLLQHPEQLLELKENPDLIATAVEECLRFESPTQMTARVASEDIDISGVTI
RKGEQVYLLLGAANRDPNIFTRADVFDITRSPNPHLSFGHGHHVCLGSSLARLEAQMAIH
TLLQRMPGLKLAESKWRYRPLFGFRALEELPVTFE
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgactattgcatcttcaactgcatcttcagagtttttgaaaaacccataccctttttac
gaaacattgcgcgctgttcatcctatatacaaagggagtttcttaaaatacccgggctgg
tatgtcacaggatatgaagaaacggcagctatcctgaaagatgccagattcaaagtccgg
accccgctccctgagacgtcaatcaaatatcaggatcttacacatgtgcaaaatcagatg
atgctgtttcagaatcagcctgatcatagacgattgcggatgccggccagcggagcgttt
actcctcgaatggcagagaggtatcgtccgtatatcgatgaaactgtccatcacttgctt
gatcaagtgcaaggtgaaaaaaagatggaggtgatttcggactttgcttttcctttagcg
agctacgtcatagccaacattataggtgtaccggcagaagatagggagcaattaaaagat
tgggctgcaagtctcattcaaacgatagattttacccggtcaagaaaggcattaatagag
ggcaatcatagcgctgtacaggctatggcatattttagagagctgattcaaaagcgaaaa
cggcatccgcagcaggatatgatcagcatgctcttgaaggggaaagaaaaggataagatg
acggaagaggaagtggcatctacgtgcatattgctagcgatcgccggacatgaaacaacg
gtcaatctcatcagcaattcaatcctttgtctgctgcagcacccagaacagcttttggag
ctaaaagaaaacccagatcttattgcgaccgcagttgaggaatgtttacgctttgaaagc
cctacgcaaatgacagccagagttgcgtctgaagatattgatattagcggggtgacgatt
cgtaaaggggaacaagtctatctgctgttaggggctgccaatcgagatccaaacatattc
acgcgcgctgatgtcttcgatatcaccagaagccctaatccgcatctttcattcgggcat
ggccatcatgtttgcctaggatcctcacttgcacgattagaagcacaaatggcgattcat
acccttctgcagcgaatgcccggcctcaagctcgctgaatctaaatggcggtaccggccg
ctttttggctttcgggcgcttgaggagctgccggtgacttttgaataa

DBGET integrated database retrieval system