KEGG   Bos indicus (zebu cattle): 109555936
Entry
109555936         CDS       T04792                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04927  Cortisol synthesis and secretion
biu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    109555936 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109555936 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ Pox_A9 T4SS_pilin
Other DBs
NCBI-GeneID: 109555936
NCBI-ProteinID: XP_019812443
UniProt: A0A6P5B1E8
LinkDB
Position
1:complement(2289563..2303833)
AA seq 194 aa
MSGXPPDLPPSPTALISEEALSSETHRHTWMILHKSAGPSPGELGAAPEGPPGSDAGMAN
RTNISAPYYSYEYYLDYLDLMPVDEKKLRANKHSIVIAFWVSLAAFVVFLFLILLYMSWS
GSPQTRNATQQPPTCSWNLGLNLPLCIWRQPSTPGPHRARSRNQTPEHPGCPAATTREPL
NLSTPGTILLSSGN
NT seq 585 nt   +upstreamnt  +downstreamnt
atgtcaggcmcaccccccgaccttcctcccagccccacagctctgataagtgaggaggcc
ttgagttcagagacccacagacatacttggatgattttacacaaatcagcggggccatct
cctggcgagctcggagcagctccggaagggccaccgggcagcgacgcaggcatggccaac
agaaccaacatctctgccccgtactacagctacgaatactacctggactacttggacctc
atgcccgtggatgagaagaagctgagagccaataaacattcgatcgtcatcgccttctgg
gtgagcctggcagctttcgtggtttttctcttcctcatccttctctacatgtcctggtca
ggctctccacagacaaggaacgccactcagcagcccccaacatgttcctggaatcttggc
ctcaacctcccgctctgcatctggaggcaacccagcaccccagggccccaccgagctcgg
tcgaggaaccagacgccggagcatcccggctgtccagcggctacaacgagagagcccctc
aacctcagcaccccagggaccatcctgctctcctctgggaactag

DBGET integrated database retrieval system