KEGG   Bos indicus (zebu cattle): 109578667
Entry
109578667         CDS       T04792                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu01524  Platinum drug resistance
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04071  Sphingolipid signaling pathway
biu04072  Phospholipase D signaling pathway
biu04114  Oocyte meiosis
biu04140  Autophagy - animal
biu04148  Efferocytosis
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04218  Cellular senescence
biu04261  Adrenergic signaling in cardiomyocytes
biu04270  Vascular smooth muscle contraction
biu04350  TGF-beta signaling pathway
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04371  Apelin signaling pathway
biu04380  Osteoclast differentiation
biu04510  Focal adhesion
biu04517  IgSF CAM signaling
biu04520  Adherens junction
biu04540  Gap junction
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04611  Platelet activation
biu04613  Neutrophil extracellular trap formation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04657  IL-17 signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu04668  TNF signaling pathway
biu04713  Circadian entrainment
biu04720  Long-term potentiation
biu04722  Neurotrophin signaling pathway
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04726  Serotonergic synapse
biu04730  Long-term depression
biu04810  Regulation of actin cytoskeleton
biu04910  Insulin signaling pathway
biu04912  GnRH signaling pathway
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04917  Prolactin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu04921  Oxytocin signaling pathway
biu04926  Relaxin signaling pathway
biu04928  Parathyroid hormone synthesis, secretion and action
biu04929  GnRH secretion
biu04930  Type II diabetes mellitus
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04960  Aldosterone-regulated sodium reabsorption
biu05010  Alzheimer disease
biu05020  Prion disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05034  Alcoholism
biu05132  Salmonella infection
biu05133  Pertussis
biu05135  Yersinia infection
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05207  Chemical carcinogenesis - receptor activation
biu05208  Chemical carcinogenesis - reactive oxygen species
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05216  Thyroid cancer
biu05218  Melanoma
biu05219  Bladder cancer
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05230  Central carbon metabolism in cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109578667 (MAPK3)
   04012 ErbB signaling pathway
    109578667 (MAPK3)
   04014 Ras signaling pathway
    109578667 (MAPK3)
   04015 Rap1 signaling pathway
    109578667 (MAPK3)
   04350 TGF-beta signaling pathway
    109578667 (MAPK3)
   04370 VEGF signaling pathway
    109578667 (MAPK3)
   04371 Apelin signaling pathway
    109578667 (MAPK3)
   04668 TNF signaling pathway
    109578667 (MAPK3)
   04066 HIF-1 signaling pathway
    109578667 (MAPK3)
   04068 FoxO signaling pathway
    109578667 (MAPK3)
   04072 Phospholipase D signaling pathway
    109578667 (MAPK3)
   04071 Sphingolipid signaling pathway
    109578667 (MAPK3)
   04024 cAMP signaling pathway
    109578667 (MAPK3)
   04022 cGMP-PKG signaling pathway
    109578667 (MAPK3)
   04151 PI3K-Akt signaling pathway
    109578667 (MAPK3)
   04150 mTOR signaling pathway
    109578667 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    109578667 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109578667 (MAPK3)
   04148 Efferocytosis
    109578667 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    109578667 (MAPK3)
   04210 Apoptosis
    109578667 (MAPK3)
   04218 Cellular senescence
    109578667 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109578667 (MAPK3)
   04520 Adherens junction
    109578667 (MAPK3)
   04540 Gap junction
    109578667 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    109578667 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109578667 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109578667 (MAPK3)
   04613 Neutrophil extracellular trap formation
    109578667 (MAPK3)
   04620 Toll-like receptor signaling pathway
    109578667 (MAPK3)
   04621 NOD-like receptor signaling pathway
    109578667 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    109578667 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    109578667 (MAPK3)
   04660 T cell receptor signaling pathway
    109578667 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    109578667 (MAPK3)
   04659 Th17 cell differentiation
    109578667 (MAPK3)
   04657 IL-17 signaling pathway
    109578667 (MAPK3)
   04662 B cell receptor signaling pathway
    109578667 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    109578667 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    109578667 (MAPK3)
   04062 Chemokine signaling pathway
    109578667 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109578667 (MAPK3)
   04929 GnRH secretion
    109578667 (MAPK3)
   04912 GnRH signaling pathway
    109578667 (MAPK3)
   04915 Estrogen signaling pathway
    109578667 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    109578667 (MAPK3)
   04917 Prolactin signaling pathway
    109578667 (MAPK3)
   04921 Oxytocin signaling pathway
    109578667 (MAPK3)
   04926 Relaxin signaling pathway
    109578667 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    109578667 (MAPK3)
   04919 Thyroid hormone signaling pathway
    109578667 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    109578667 (MAPK3)
   04916 Melanogenesis
    109578667 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109578667 (MAPK3)
   04270 Vascular smooth muscle contraction
    109578667 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109578667 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    109578667 (MAPK3)
   04725 Cholinergic synapse
    109578667 (MAPK3)
   04726 Serotonergic synapse
    109578667 (MAPK3)
   04720 Long-term potentiation
    109578667 (MAPK3)
   04730 Long-term depression
    109578667 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    109578667 (MAPK3)
   04722 Neurotrophin signaling pathway
    109578667 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    109578667 (MAPK3)
   04380 Osteoclast differentiation
    109578667 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109578667 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109578667 (MAPK3)
   05206 MicroRNAs in cancer
    109578667 (MAPK3)
   05205 Proteoglycans in cancer
    109578667 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    109578667 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    109578667 (MAPK3)
   05203 Viral carcinogenesis
    109578667 (MAPK3)
   05230 Central carbon metabolism in cancer
    109578667 (MAPK3)
   05231 Choline metabolism in cancer
    109578667 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109578667 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109578667 (MAPK3)
   05212 Pancreatic cancer
    109578667 (MAPK3)
   05225 Hepatocellular carcinoma
    109578667 (MAPK3)
   05226 Gastric cancer
    109578667 (MAPK3)
   05214 Glioma
    109578667 (MAPK3)
   05216 Thyroid cancer
    109578667 (MAPK3)
   05221 Acute myeloid leukemia
    109578667 (MAPK3)
   05220 Chronic myeloid leukemia
    109578667 (MAPK3)
   05218 Melanoma
    109578667 (MAPK3)
   05211 Renal cell carcinoma
    109578667 (MAPK3)
   05219 Bladder cancer
    109578667 (MAPK3)
   05215 Prostate cancer
    109578667 (MAPK3)
   05213 Endometrial cancer
    109578667 (MAPK3)
   05224 Breast cancer
    109578667 (MAPK3)
   05223 Non-small cell lung cancer
    109578667 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109578667 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    109578667 (MAPK3)
   05161 Hepatitis B
    109578667 (MAPK3)
   05160 Hepatitis C
    109578667 (MAPK3)
   05171 Coronavirus disease - COVID-19
    109578667 (MAPK3)
   05164 Influenza A
    109578667 (MAPK3)
   05163 Human cytomegalovirus infection
    109578667 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109578667 (MAPK3)
   05165 Human papillomavirus infection
    109578667 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109578667 (MAPK3)
   05135 Yersinia infection
    109578667 (MAPK3)
   05133 Pertussis
    109578667 (MAPK3)
   05152 Tuberculosis
    109578667 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109578667 (MAPK3)
   05140 Leishmaniasis
    109578667 (MAPK3)
   05142 Chagas disease
    109578667 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109578667 (MAPK3)
   05020 Prion disease
    109578667 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    109578667 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    109578667 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    109578667 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109578667 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109578667 (MAPK3)
   04934 Cushing syndrome
    109578667 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109578667 (MAPK3)
   01524 Platinum drug resistance
    109578667 (MAPK3)
   01522 Endocrine resistance
    109578667 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109578667 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:biu03036]
    109578667 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109578667 (MAPK3)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109578667 (MAPK3)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109578667 (MAPK3)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     109578667 (MAPK3)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109578667 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 109578667
NCBI-ProteinID: XP_019843641
UniProt: A0A6P5DZC2
LinkDB
Position
25:27971251..27978050
AA seq 380 aa
MXAAAAAQGGGGGEPRGTDGVGPGVPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSA
YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DPKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETXRFQPGVLEAS
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggsggcggcggcggcggctcaggggggcgggggcggggagccccggggaactgatggg
gtcggcccgggggtcccaggggaggtagagatagtaaaggggcagccgttcgacgtgggc
ccgcgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagct
tacgaccacgtgcgcaagactcgagtggccatcaagaaaatcagcccctttgagcatcag
acctactgccagcgcacattgcgagagattcagattctgctgcgcttccgccatgagaac
gtcattggcatccgagacattctgcgggcacccaccctggaagccatgagggatgtctac
atcgtacaggacctgatggagacagacctgtacaaattgctcaaaagccagcagctgagc
aacgaccatgtatgctacttcctgtaccagatcctgcggggcctgaagtatatccactcc
gccaacgtgctccaccgggatttaaagccctccaacctgctcatcaacaccacctgcgac
cttaagatctgtgatttcggtcttgcccggattgctgatcccgagcatgaccacactggc
tttctgacggaatacgtggccacacgctggtaccgggccccagagatcatgcttaactcc
aagggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctc
tccaaccggcccatcttccccggcaagcactacctggaccagctcaaccacattctgggt
attctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcccgaaac
tacctacagtctctgccctccaagaccaaggtggcctgggccaagctttttcctaagtca
gaccccaaagctcttgacctgctggaccggatgttgacctttaaccccaacaaacggatc
acagtggaagaagcgctggctcacccctacctggagcagtactatgacccaacggatgag
ccagtggccgaggaacctttcaccttcgacatggagctggatgatctacccaaggaacga
ctgaaggagctcatcttccaggagacakcccgcttccagcctggggtgctggaagcctcc
taa

DBGET integrated database retrieval system