KEGG   Bacillus sp. JS: MY9_2001
Entry
MY9_2001          CDS       T02027                                 
Name
(GenBank) plipastatin synthetase
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bjs  Bacillus sp. JS
Pathway
bjs01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    MY9_2001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bjs01008]
    MY9_2001
Polyketide biosynthesis proteins [BR:bjs01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    MY9_2001
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: AFI28536
LinkDB
Position
complement(2027313..2034980)
AA seq 2555 aa
MPQQPEIQDIYPLSFMQEGMLFHSLYDEQSRAYFEQASFTINGQLNLERFQKSMDAVFDR
YDIFRTAFIYKNVAKPRQVVLKQRPCHVHFEDISHLNEKDKEHCTEAFKEQDKSRGFDLQ
TDVLMRISILKWAPGRYVCIWSHHHILMDGWCLGIVIKDFLHIYQALGKGQLPDLPPVQP
YGTYIKWLMQQDREEAAEYWKKRLQHFEKSTPLPKRTDQIPNGTLQQITFTIPEKETAEL
QKIAAASGATLNTVFQALWGIMLQKVNRSSDAVFGSVISGRPSELKDVENMVGLFINTIP
IRAQSDSLSFSDLVRRMQKDMNEAEAYSYFPLYDIQAQSALKQELIDHIIVFENTPTQQE
IEEMNQAGSFDFSVKDFEMEEVTNYSCSVKVIPGRTLSVRIHFQTSAYQPSMMSEIKDYL
LHMVSDVISDPSLPVSKMTLLDENKTRKIVSQNNRSVSVSPEAPTLHGLFERQAAFTPER
TAIRFSGGSLTYAELDMYASRLAARLAARGVSKESIVGVLSERSPDMLIAVLAVLKAGGA
YLPLDPEYPEERLSYMLKDSGADLLLTQPGCSAPSFSGETLEVDLTSLGREKAENHVFVS
ADSGSLAYVIYTSGSTGQPKGVAVEHRQAVSFLTGMQHQFPLSEDDIVMVKTSFSFDASV
WQLFWWSLSGASAYLLPPGWEKDPALIVKAIHQEKVTTVHFIPAMLNSFLDQAEIVTLSD
GTSLKRVFAGGEPLAPRVAVRFASLLPEVSLIHGYGPTEATVDAAFYVLDPERDRDRFRI
PIGKPVPGARLYVLDPHLAVQPLGVSGELYIAGAGVARGYLNRPALTEERFLEDPFYPGE
RMYKTGDIARWLPDGNMEFLGRTDDQVKIRGYRVEPGEIEAALRSIEGIREAAVTVRTDS
GEPELCAYIEGLPRNEVRAQLERRLPGYMIPAHMIEMEQWPVTPSGKLDRNALPAPNGAA
DAETYTAPRNVTEMKLAQLWEDVLKNGPVGIHDNFFDRGGHSLKATALVSRISKEFDVQV
PLKDVFAHPTIEGLASVIREGTDSPYEAIKPTEQRETYPVSSAQKRIYVLQQLEDGGTGY
NMPAVLELEGKLNPERLDRAFKELINRHESLRTSFEQDGGGEPVQRIHDEVPFTLQTTVL
GDQTEQGAAAAFIKPFDLSQAPLFRAQIVKVSDERHLLLVDMHHIISDGVSVNILIQEFG
KLYNNRTLPALHIQYKDYAVWQEGFKTGDAYQTQEAYWLKQLEGELPVLDLPADQPRPPV
RSFAGDKVSFTLDQEAASGLHKLARENGSTLYMVLLAAYTALLSRLSGQEDIIIGSPIAG
RPHKDLEPILGMFVNTLALRTRPEGGKPFVQYLQEVRETALEAYEHQDYPFEELVDKLEL
TRDMSRNPLFDVMFVLQNMDQESLDLDELCLKPAANNGHQTSKFDLTLYAQEQPHGLLTF
QMEFSTDLYKKKTIEKWLQYFINMLLSIIQDNKAVLGTINILNEDEAHYLIHELNRTKMD
YPRNETISRLFEMQAEQTPNAIAIVSDTQELTYADLNSWANQIASLLQRKGVGPDRVVAL
LAGRTPELIAGMLGILKAGGAYLPIDSNLPVERIAYMLSDSRAALLLQSEKTEKQLLGIE
CEQIIIEDIQKQGEAKNVESSAGPHSLAYIIYTSGSTGKPKGVMIEQRSVIRLVKNSNYI
TFTPADRLLMTSSIGFDVGSFEFFGPLLNGAALHLSDQQTFLDSQQLKRYIEHQGITTMW
LTSSLFNHLTEQLETTFSQLNHLIIGGEALSASHVNRIRNACPEVSIWNGYGPTENTTFS
TCFHIQKTYELSIPIGRPVGNSTAYIFNQWGMLQPAGAVGELCVGGDGVARGYLHRPDLT
KEKFVKNPFVPGDRLYRTGDLARWLPDGTIEYVGRIDDQVKVRGYRVELGEIESALRHID
GVKEAAVLARTGQSGSKELFGYISVKAGTNAEQVRSLLARSLPNYMIPAYIIEMENLPLT
SNGKLNRKALPEPDFASKQTYIPPRNELEEQLALIWQEVLGIQRIGIEDSFFELGGDSIK
ALQVSARLGRHGLSLQVSDLFRHPKIKDLSPFIRKTERVIEQGPVQGDVPWTPIQKWFLS
QDIEERHHFNQSVMLFHTDRLSEDALRASLKKLAEHHDALRMVYRNDGGRWIQINQGIHE
SQLYRLKISDLSQSENDWETQIKREVADLQQSINLQEGPLLHAAWFKTLTGDYLFLAIHH
LVVDGVAWRILLEDLSAGYQQASSGQPIDLPPKTDSYQEYARRIQEYAQSSKLIREEAYW
RSAEEQQTAELPYEMPFHENTGCSKRDSVSFSLSEADTDVLLQNVNHAYGTDTQDILLTA
ASLAICEWTGGSKLRIAMEGHGREHIMPELDISRTVGWFTSMYPALISFENQRDELGTAV
KTVKDTLGRIPNKGIGYGMLKYLTHPENKSIAFSKTPEISFNYLGQFNDIERQGSFRPSS
LGSGKDITHTWKREQIIEISAMAADKKLHFNLSYPPARFHRNTMDQLINRIEHFLLDIMK
HCAGKQKAEKTLSDFSSQSLTAEDLDSISSLVEEL
NT seq 7668 nt   +upstreamnt  +downstreamnt
atgccgcagcaacccgaaatacaggatatataccctttgtcttttatgcaggaagggatg
ctttttcactcattgtatgatgaacagtcgagagcttattttgaacaggcctcttttacg
atcaatggacagcttaacttggagcgtttccagaaaagtatggatgctgtttttgacagg
tacgatatctttcgaacagcattcatctataaaaatgttgccaagcctcgtcaggtcgtg
ctcaagcaacgtccttgccatgttcattttgaagatatttctcatctcaatgaaaaagat
aaagaacattgtacagaggcattcaaagagcaggataaatccaggggattcgatctgcaa
acggatgtactaatgagaatatctattttaaaatgggcgcctggtcgttatgtctgtatt
tggagccaccatcatattttaatggatggctggtgtttaggcattgtcattaaagatttt
cttcacatttatcaagcgctgggtaaaggccagcttcctgatttgcctcccgtacagccg
tacgggacgtatattaaatggctgatgcagcaagatcgtgaagaagcagctgagtactgg
aaaaagagacttcagcatttcgaaaaatctacacccctgccgaaaagaacagatcaaatt
ccgaatgggacactacagcaaatcacgtttaccattcccgaaaaagaaaccgccgaatta
cagaaaatcgcagcagcttctggtgcgacactaaacactgttttccaagctttatggggg
attatgcttcaaaaggtcaatcgcagcagcgatgctgtgttcggttcagttatatcaggc
agaccttctgagctaaaagatgtggaaaacatggtcgggctttttatcaataccattcct
attcgagcccaaagtgattctctgtctttttctgacctagtcaggagaatgcaaaaggac
atgaatgaggcagaagcctatagttactttcccttgtatgatattcaggcgcagagtgct
cttaagcaagaattgatcgatcatattatcgtctttgaaaatacacctacccagcaagag
atcgaagagatgaatcaagcggggtcatttgatttctccgtcaaagattttgagatggaa
gaggtgaccaattatagttgcagtgtcaaagtgatcccaggccgtaccttgtccgttcgg
attcattttcagaccagcgcttatcaaccaagcatgatgtccgaaataaaagattatttg
ctgcacatggtctctgacgtcatctctgatccatctcttcctgtgtcaaagatgacattg
cttgatgagaacaaaacacggaaaatcgtttctcaaaacaacaggtcagtatctgtttcg
cctgaagccccaactttgcacggtctgtttgaacgacaggcggctttcacaccggagcgg
acagccatccgattttcaggcggttcgctgacgtacgctgagcttgacatgtatgccagc
cggctggctgcccgccttgcggcacgcggcgtctcaaaggaaagcatcgtaggtgtcctg
tctgagcggtcacctgacatgctgatcgctgtacttgctgtattaaaagctggcggggcg
tatttgccgcttgatcctgagtatccagaagagcggctgagctacatgctgaaagacagc
ggggcggatctcttactgacacagccgggatgctccgcaccgagcttttccggagagacg
cttgaagttgacctgacatctcttgggagagaaaaagcagaaaaccatgtatttgtttct
gctgacagtggttctctcgcctatgtcatctatacgtctggctccaccgggcagccaaaa
ggggtagccgtcgagcaccgccaggctgtttcctttctgaccggcatgcagcaccaattt
ccgctttcggaagatgacattgtcatggtgaaaacctctttttcctttgatgcgtctgtg
tggcagctgttttggtggtcgctttccggtgcttcggcttatctgcttcctccgggctgg
gagaaagatccggcattgattgtcaaagccattcatcaggaaaaggtgacaacggttcat
tttattccggctatgctgaacagttttctcgatcaagcggaaatcgtaacactaagtgac
gggacaagcctgaagcgtgtatttgccggaggtgaaccgcttgcaccccgtgtggcagtg
cgatttgcttctttattgcctgaggtatcgctgatccatggctatgggccgacagaagca
acggttgacgcggcattctacgtgttggacccagagcgggacagggaccgctttaggatt
ccgatcgggaagcctgtacccggtgcgcgtttgtatgttttagatccccatttagccgta
cagcccttaggggtctcaggcgaactgtacattgccggagcgggtgtggccagaggctat
ctgaatcggccggccttaacggaggagcgttttcttgaggacccgttttacccgggggaa
cgcatgtacaaaacaggggatatagcccgctggctccctgacgggaatatggaattcctc
ggccgcacggatgatcaggtgaaaatccgtggttaccgggttgagcctggagaaattgaa
gcggcgcttagaagcatagaaggcataagggaagcggccgttaccgtacggacagacagc
ggcgagccggaattatgcgcttatatagaaggactcccgagaaacgaagtgcgggcgcag
cttgagagacggctgccgggctacatgatcccagcccatatgatcgagatggaacagtgg
ccggttacgccaagcggaaagctggaccggaacgccctgccagctcctaacggagcggca
gatgcagagacctacacagcgccaagaaatgtgaccgagatgaagcttgcccagctgtgg
gaagacgtcctgaaaaacggccctgtcgggattcacgacaacttctttgaccgcggagga
cattccttaaaagcaacggcgcttgtctcccgaatctcaaaagaatttgatgtacaggtg
ccgctgaaagatgtgtttgcccatccgacgatagaaggactggcttctgttatccgtgaa
ggaacggacagtccatatgaagcaataaaaccgacggaacagcgtgaaacctatccggtt
tcctctgcccaaaaacggatttatgtccttcagcagctggaggacggagggacaggctac
aatatgccggcggtattggagctggaaggaaagctcaatcccgaaaggctggacagggct
ttcaaagagctgatcaatcgccacgagtcgcttcggacctcctttgaacaggatggaggc
ggcgagccggtgcagcgcatccatgacgaggtgccgttcacattacagacgacagttcta
ggcgaccaaaccgaacagggggccgcagccgcgtttatcaagccgtttgatctcagccaa
gcgcctctgttccgtgcccaaatcgtaaaggtatcagatgagcggcacctgttgctggtt
gatatgcatcacatcatttcagacggtgtttccgtcaacattctgattcaggaattcgga
aagctgtacaacaaccggacccttccggcgcttcatattcaatataaagattatgccgta
tggcaagaaggattcaaaacaggagacgcgtaccagacgcaggaggcgtactggctgaag
cagctcgagggcgagctgccggtgctggatctcccggctgatcaaccccgcccgccggtg
cgaagctttgcgggtgacaaggtctcatttacgcttgatcaagaagcggcatcagggctt
cacaagctggcacgggagaatggaagcacactgtacatggtgctccttgcggcctacaca
gcgttattgtcacgcttaagcggacaggaagatatcatcatcggctcgccaattgccggc
cggccgcacaaggatctcgagccgatactcggcatgtttgtgaacacgctggcgctgcgg
acacgcccggagggcgggaagccgtttgtacagtatttgcaggaagtgcgcgagacagca
ttggaagcctacgagcatcaggattatccgttcgaagagcttgtcgataagcttgaattg
acaagggatatgagccggaatccgctctttgacgtcatgtttgttcttcaaaacatggat
caggaatcgttggacctggatgaactgtgtctcaaacctgcagcaaacaatgggcatcaa
acgtccaaatttgatttaacgctatatgctcaggaacagccccacggtttgctgacgttc
caaatggagtttagtactgacttatataagaaaaaaacgatagaaaagtggcttcaatac
ttcatcaatatgttactctccatcatccaggacaacaaagccgttctcggaacaataaat
atcctgaatgaagatgaggcccattaccttatccatgaactcaatcgtacaaaaatggat
tatccaagaaatgaaaccatcagcagactctttgaaatgcaggcggaacaaacgcctaat
gccatagcaattgtcagcgatacacaagagttaacttacgcggatctgaacagctgggca
aatcaaattgcttcacttctacagagaaagggagtcggtcccgatcgagtcgtagccttg
ttggcaggacgaacgccagaactcatagcaggtatgctgggcattctgaaagccggggga
gcctatctgcctatcgattctaatctgcctgttgaacggatagcttatatgctgtctgac
agcagggcagcattactccttcaatctgaaaaaacagaaaaacagctattaggcattgaa
tgtgaacaaatcataatcgaagatattcaaaagcaaggagaggcgaagaacgttgaatct
tcagcagggccccattcacttgcatatatcatttatacctctggatcaaccggtaaacca
aagggtgtcatgattgagcagcgaagtgtcattcgtcttgtgaaaaacagcaattatatt
acatttacacctgctgaccgccttctgatgacatcatcaatcggttttgacgttggatca
tttgaattttttggaccgctgttaaatggtgccgctttgcacctgtccgatcaacaaacc
tttctcgattcccaacagcttaagagatacatagaacatcaaggaatcacaacgatgtgg
ctgacctcgtctctattcaatcatttgacagagcaactcgagacaacattttcgcagctt
aaccatctgatcataggcggagaagctttgtcggcaagccacgtcaatcgaatcagaaat
gcctgcccggaagtatcgatatggaacggatatgggccaaccgaaaatacaactttttcg
acatgcttccacattcaaaaaacatatgaactctccattccgatcgggcggccggttggc
aattccaccgcatatatcttcaatcaatggggaatgctgcagccggccggagctgttggc
gaactttgtgtcggcggagatggcgttgccagagggtatttacaccgtcctgatttaacg
aaagagaaatttgtcaaaaacccatttgtacccggcgatcgactgtaccgcacaggtgat
ctggcgcgctggcttcccgatggcacaattgagtacgttggccgtattgatgatcaagta
aaagtcagaggctatcgggtagagctgggtgagatcgaatcagcacttcgccacatagac
ggagtcaaagaagcggcggtgttggcacgtacaggacagtcagggagcaaagagctgttt
ggctatatcagcgtaaaagcgggcacgaatgctgaacaagtgcgttctcttctcgcccgt
tcactgcctaattatatgattccggcgtatatcattgaaatggagaatcttccgctcaca
tcgaacggcaaattgaaccggaaagcactgcctgaaccagatttcgcatctaaacaaaca
tacatcccgccacgcaacgaacttgaagagcagctggcattgatctggcaggaggttcta
ggcatccagaggatcggaatagaggattcattctttgaattgggcggcgattccatcaaa
gcgcttcaagtttctgcacgtctcgggcgccacgggttaagcttgcaggtaagtgattta
ttccgtcatccaaagataaaagacttatcaccatttattcgtaaaacagagagagtcata
gaacaaggacctgttcagggagatgttccatggacgcctattcagaaatggtttctctca
caagacatagaagaacgacaccatttcaatcagtctgtcatgcttttccatactgaccgt
ttgtctgaagacgctcttagagcatccttaaaaaagctggcggagcatcatgatgcgctt
cggatggtttatcgtaacgatggcgggcgatggattcaaatcaaccaaggcattcatgaa
tcacagctatacaggttaaaaatatctgatctttcacaatctgaaaacgattgggaaaca
caaatcaaacgagaagttgcagatcttcagcaaagcatcaatttgcaggaagggccattg
ttacatgccgcgtggtttaaaacactgaccggagattacttgttcctcgcgatccatcat
ctagtcgttgacggtgtggcatggcggattttgctggaggatttgtcagcagggtaccaa
caagcgtcctcaggccagccgattgatcttccgcctaaaactgattcctatcaggaatac
gccagacggattcaggaatatgcccaaagcagcaagctgattcgtgaagaggcgtattgg
cgaagtgcagaagaacagcaaactgcggaactgccatatgaaatgccgtttcatgagaac
accggctgcagcaagagggactcggtaagcttttcactctctgaagcagacactgacgtt
ttgctgcaaaacgtcaatcacgcctatggcacagatacacaagatattctgttaaccgca
gcatcgttggcgatttgtgaatggacaggaggaagcaagctccgaatcgctatggaagga
cacggaagagagcacattatgccggagttggatatcagccggacggtcggctggtttaca
tccatgtacccggccctcataagctttgaaaatcaaagggatgagctgggaaccgcagta
aaaaccgttaaagatacactgggccggataccaaacaaagggataggttacggtatgctg
aaatacctcacacaccctgaaaataaaagcattgcgttttcaaaaacacctgaaatcagc
tttaactatttgggccagttcaacgacatcgaaagacagggcagcttccgcccatcaagt
cttggaagcggaaaggatatcactcatacatggaagcgtgagcaaatcatagagataagt
gcaatggcagcagacaaaaagcttcatttcaatcttagctatccgccggcccgtttccat
agaaacacaatggaccagcttatcaacaggatcgaacactttttgctggacattatgaaa
cactgcgccggtaaacaaaaagcagaaaagacactgagcgattttagcagtcaatcatta
acggcagaggatttggacagtatatccagcttggtggaagaattgtag

DBGET integrated database retrieval system