KEGG   Cytobacillus kochii: CKF48_02170
Entry
CKF48_02170       CDS       T05194                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
bko  Cytobacillus kochii
Brite
KEGG Orthology (KO) [BR:bko00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bko03000]
    CKF48_02170
Transcription factors [BR:bko03000]
 Prokaryotic type
  Other transcription factors
   Others
    CKF48_02170
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: ASV66241
UniProt: A0A248TDF4
LinkDB
Position
complement(432423..433388)
AA seq 321 aa
MKRALIKWGSLVLCLLLLSSCGQVFSGGQLQKAGLLVPDTINDQVWGTKGYKGLLKIQST
YDIDVYYKEGMNSQLVVERAVKEFSKKGVNLIFGHGNEYAEYFNQISAQYPDIQFISFNG
DAQNENTTSLNFEGYAMGFFGGMVAGEMTSTNIVGIIAAFEWQPEVKGFIDGVNFQNDEA
NVKIHYVENWDDAHKAAGLMDKLVIEKADVVYPAGDGYNVPVIEKVKEHGLYAIGYVSDQ
SHLGKSAVLTSTIQHVDHLYEIVAEQFHNGELQSGNLSFDFQDDVISLGAYSPELSPTFI
QQLNAAVKKYKETGNLPKEPS
NT seq 966 nt   +upstreamnt  +downstreamnt
atgaagagagctttaattaagtgggggagtttggttctatgccttcttctattatcgtca
tgtggacaggtattttctgggggtcagctgcaaaaggctggcttattagtgccggatacc
attaatgatcaagtgtggggtacgaaagggtataaaggcctactcaagatacagtctact
tatgatattgatgtgtattataaagaaggaatgaactcacaactcgttgtcgaaagagcg
gtaaaggaattttcaaaaaaaggggtcaatttaatttttggacatggaaatgaatatgca
gagtactttaatcaaatatcagcacaatatccagacattcagtttataagctttaacggg
gacgcacaaaatgaaaatacgacaagtttaaattttgaaggatatgcaatgggctttttc
ggaggtatggtggctggtgagatgacatctactaatattgttggtattattgcggcattt
gaatggcagccagaagtaaaaggttttattgatggtgtgaactttcaaaatgatgaagca
aatgttaaaatacattatgttgaaaattgggatgatgcccataaggctgcggggttaatg
gacaagttggtcatagaaaaagcagatgtcgtttatccagcaggtgatggatataatgtc
cctgtcattgaaaaagtaaaagagcatggtttatatgccattggttatgtttctgaccaa
tcccatttaggaaaatcagcagtattaacaagtacaattcaacatgttgaccatttgtat
gaaatagtagcagaacaatttcataatggagaactgcagtctgggaacctttcttttgac
tttcaagatgatgtcatttcattaggtgcgtatagtccagaattatctccaacctttatt
caacaattaaatgcagcagtaaaaaaatataaagaaacaggtaatttaccgaaagaacca
tcatag

DBGET integrated database retrieval system